KEGG   Mus musculus (mouse): 208449
Entry
208449            CDS       T01002                                 

Symbol
Sgms1, 9530058O11Rik, AI841905, C80702, Mob, Sms1, Sor1, Tmem23
Name
(RefSeq) sphingomyelin synthase 1
  KO
K04714  shingomyelin synthase [EC:2.7.8.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    208449 (Sgms1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    208449 (Sgms1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.27  sphingomyelin synthase
     208449 (Sgms1)
SSDB
Motif
Pfam: PAP2_C SAM_1 SAM_3 PAP2 SAM_PNT SAM_2 PAP2_3
Other DBs
NCBI-GeneID: 208449
NCBI-ProteinID: NP_001161997
MGI: 2444110
Ensembl: ENSMUSG00000040451
Vega: OTTMUSG00000033408
UniProt: Q8VCQ6
Structure
Position
19:complement(32100127..32367285)
AA seq 419 aa
MLSARTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLYRVSS
DNGQRLLDMIETLKMEHHMEAHKNGHANGHLSIGVDIPNPDGSFSIKTKPNGMPNGFRKE
MIKIPMPEPERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFF
DHFNRVQWAFSICEINGMILVGLWLFQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTT
LPVPGMHFNCSPKLFGDWEAQVRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYL
FIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQ
VLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgttgtctgccaggaccatgaaggaagtggtttactggtcacccaagaaggtggcagac
tggctgctggagaatgctatgccagaatactgtgagcctctggagcacttcacaggccag
gacttaatcaacctaacccaagaggatttcaaaaaacccccactgtaccgagtctcctct
gacaatgggcagcgactcttagacatgatagagaccctgaagatggagcaccatatggaa
gcacacaagaatggccacgccaacggacacctcagcattggcgttgacattcccaacccc
gatggcagcttcagcatcaagactaaacccaacggaatgccaaatgggtttaggaaagag
atgatcaagatccccatgccagaaccggagcgctcccagtatcccatggagtggggcaag
actttcctggcctttctttatgcactttcctgttttgttctcactacagtgatgatctcg
gtcgtccatgaacgagtacctcctaaggaggtgcagcctccactaccggacacgtttttt
gaccattttaaccgggtgcagtgggcgttttctatttgcgaaattaacggcatgatcctt
gtaggactctggctatttcagtggctgctcttaaaatacaagtctattattagcagaaga
tttttctgcatagttggcacgctgtacctgtatcggtgtattacaatgtatgtaactaca
ctcccagtacctggcatgcatttcaactgttctccgaagctctttggagactgggaagct
caagtgcggagaataatgaagctcattgctggaggtggcttatccatcacaggctcgcac
aacatgtgtggcgactatctgtacagtggccacacggtcatgctaacgctcacctaccta
tttatcaaagagtattctcctcggcggctctggtggtaccactggatttgctggctcctc
agcgtcgttggaatcttctgtattctcttagcgcatgaccactacactgtggacgtggtg
gtggcctactacatcaccacaagactcttctggtggtatcacacgatggccaatcagcaa
gtgcttaaggaagcctcccagatgaacctcctggccagggtgtggtggtacaggccattt
cagtactttgaaaagaatgtccaaggaattgtacctcgatcttaccattggcccttcccc
tggccggtagtccaccttagtaggcaagttaaatatagccggctggtaaacgacacataa

DBGET integrated database retrieval system