KEGG   Mus musculus (mouse): 20847
Entry
20847             CDS       T01002                                 

Gene name
Stat2, 1600010G07Rik, AW496480
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    20847 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20847 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20847 (Stat2)
   04625 C-type lectin receptor signaling pathway
    20847 (Stat2)
   04062 Chemokine signaling pathway
    20847 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    20847 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20847 (Stat2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    20847 (Stat2)
   05160 Hepatitis C
    20847 (Stat2)
   05171 Coronavirus disease - COVID-19
    20847 (Stat2)
   05164 Influenza A
    20847 (Stat2)
   05162 Measles
    20847 (Stat2)
   05168 Herpes simplex virus 1 infection
    20847 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    20847 (Stat2)
   05169 Epstein-Barr virus infection
    20847 (Stat2)
   05165 Human papillomavirus infection
    20847 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20847 (Stat2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    20847 (Stat2)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int STAT2_C SH2 IRF-2BP1_2
Other DBs
NCBI-GeneID: 20847
NCBI-ProteinID: NP_064347
MGI: 103039
Ensembl: ENSMUSG00000040033
UniProt: Q9QXJ2
Structure
PDB: 
5OEN

Position
10 D3; 10 76.5 cM
AA seq 922 aa
MAQWEMLQNLDSLFLDQLHQVYSQSILPMDVRQHLATWIEDQNWREAALGSDDAKANMLY
FSILDQLNQWDHYSSDSNHFLLQHNLRKFSRDIQTFPNGPTQLAEMIFNLLLEEQRILNQ
AQRAQEVQPPPAPEAVVESQQLEIENRIQGLHVDIEFLVRSIRQLKDEQDVFSFRYTVFS
LKKTSSSDPHQSQQAQLVQATANKVDRMRKEVLDISKGLVGRLTTLVDLLLPKLDEWKVQ
QQKSCIGAPPPELQLEQLEQWLTAGAKFLFHLRQLLKQLKEMSHMLRYKGDMFGQGVDLQ
NAQVMELLQRLLQRSFVVETQPCMPQTLHRPLILKTGNKFTVRTRLLVRLQEGSESLKAE
VSVDRNSDLPGFRKFNILTSNQKTLTPEEGQRQGLIWDFGFLTLVEQRAVGAGKGNKGPL
AVTEELHVISFVVEYVYQGLKMKLQTDTLPVVIISNMNQLSIAWASILWFNMLSPNPKNQ
QFFCQAPKAPWSLLGPVLSWQFSSYVGRGLDSEQLGMLRTKLFGKSCKMEDALLSWVDFC
KRESPPGKIPFWTWLDKILELVHDHLKDLWKDGRIMGFVSRNQERRLLKKMLSGTFLLRF
SETSEGGITCSWVEHQDDDKVEIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENIPENPLR
FLYPRIPRDEAFGCYYQEKVNFEEQRKYLKHKLIVISNRQVDELQQPLELKQDSESLEVN
AELLLAHDQELPLMMQTGLVLGTELKVDPILSTAPQVLLEPAPQVLLEPAPQVPLEPAPQ
VLLEPAPQVLLEPAPQVLLEPAPQVLLEPAPQVQLEPAPQVLLELAPQVLLEPAPQVLLE
LAPQVQLEPAHLLQQPSESDLPEDLQQISVEDLKKLSNPSTEYITTNENPMLAGESSGDE
TSIPYHSHFDADGLLGWTLDTF
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaaccttgacagcctgttcctggaccagttacaccag
gtctactcacagagcatcctgccaatggacgttcgacagcatttggctacctggattgaa
gaccagaactggagggaagctgcgctgggcagtgatgacgccaaggccaacatgctatac
ttcagcatcctggaccaactgaaccagtgggaccactacagctcagactccaatcacttt
ttattacagcataacttgcgaaaattcagccgggatattcagacctttcccaatggccct
acccagttggctgagatgatctttaatcttcttctggaagagcaaaggattctgaatcag
gctcaaagagctcaagaggtgcagcccccaccagcccccgaagcagttgtggagagccag
cagcttgagattgaaaatcgaatccagggtttacatgtggacattgagttcttggtgaga
tccatcaggcagctgaaggacgaacaggatgtcttcagcttcagatacacagttttcagt
ctgaagaagacgtcgtcttcagacccccatcagagccaacaggcgcagcttgtgcaggca
acagccaacaaagtcgacagaatgagaaaggaggtgctggacatctccaaaggactggtt
ggccgattaaccaccctggtcgacctattgctgcccaagctggacgagtggaaggtgcag
cagcagaagtcctgcattggagccccgccccccgagctgcagctggaacagctggaacag
tggttgacggctggagcaaagttcttgttccaccttcggcagctactgaagcagctgaag
gagatgagtcacatgcttcggtataagggtgacatgtttggccaaggggtggacctgcag
aatgcccaagtcatggagttacttcagcgtctgctccaaaggtcctttgtagtagaaacc
cagccctgcatgccccagactctccaccgacccctcatcctgaagactgggaacaagttc
accgtccgaacaagacttctggtgagactccaggaaggcagcgaatcactcaaagcagaa
gtctctgtcgacaggaattcagacttaccaggcttccggaagttcaacattctgacctca
aaccaaaaaaccttgaccccggaggagggccagagacagggcttaatttgggacttcggc
ttcttgactctggtggagcaacgcgctgtgggtgcaggaaagggcaacaaggggccgctg
gcagtgacagaggagttacatgtcatcagcttcgtggttgagtacgtgtaccagggtctg
aagatgaagctgcagacggacactctccctgttgtgattatttctaacatgaaccaactc
tccattgcctgggcctccattctctggttcaacatgctcagcccaaatcccaagaaccag
cagttcttctgccaagctccgaaagccccctggagtttgctgggacctgtgctcagctgg
cagttctcctcttacgttggccgaggcctcgattctgagcagctgggcatgctgagaacc
aagctgtttggaaagagctgcaagatggaggatgcgctgttgtcctgggtagacttttgc
aagcgagagagcccccctggtaagatccctttctggacctggctggacaaaattctggag
ctggtgcacgaccacctgaaggatctctggaaggatgggcgcatcatgggctttgtgagc
cgcaaccaggaacgcagactgctgaagaagatgttgtctggcaccttcctactgcgcttc
agtgaaacttctgaagggggcattacttgttcttgggtggagcaccaggatgacgataaa
gtcgaaatctactcagtgcagccctacaccaaggaagtgttacagtcactcccactgaca
gagatcatccgccactaccaggttcttgccgaagagaacatccccgagaacccactccgc
ttcctctatccccgaatccctcgggacgaagcttttgggtgttactaccaggaaaaagtt
aattttgaagaacagaggaaatatttgaaacataaactcattgtgatctctaacagacag
gtggacgagctgcagcagcctctggagctcaaacaggattcagagtccttagaagtgaat
gcagagctcttgttagcacacgaccaggagttgccattgatgatgcagactgggctggtt
ctgggcacagagctgaaagtggaccccatactgagtacagccccacaagtcctgctggag
ccagccccacaagtcctgctggagccagccccacaagtcccgctggagccagccccacaa
gtcctgctggagccagccccacaagtcctgctggagccagccccacaagtcctgctggag
ccagccccacaagtcctgctggagccagccccacaagtccagctggagccagccccacaa
gtcctgctggagctagccccacaagtcctgctggagccagccccacaagtcctgctggag
ctagccccacaagtccagctggagccagcacacttgctgcagcagccatcagagtcagat
ttgcctgaggacctgcagcagattagcgtggaggatctgaaaaaattaagcaacccgagt
actgaatacatcacaaccaacgaaaacccaatgttggctggcgagagcagtggagatgag
acttccataccctaccacagccattttgatgcggatggactcttgggatggactcttgat
accttctga

DBGET integrated database retrieval system