KEGG   Mus musculus (mouse): 208501Help
Entry
208501            CDS       T01002                                 

Gene name
Ndufaf8, 1810043H04Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 8
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH CX9C
Motif
Other DBs
NCBI-GeneID: 208501
NCBI-ProteinID: NP_001103712
MGI: 1913676
Ensembl: ENSMUSG00000078572
Vega: OTTMUSG00000004101
UniProt: A2AMZ4
Position
11; 11 E2
AA seq 74 aa AA seqDB search
MSVNGAVWGRVRSRFRAFPEHLAACGAEASAYGKCVQASTAPGGRLSKDLCVREFEALRS
CFAAAAKKTMMGGS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaacggagcggtgtgggggcgtgtgcggagccgtttccgagccttccccgag
catctggcggcctgtggagctgaggcctcggcttatggcaagtgcgtgcaggcgtccacc
gccccaggaggccgcctgagtaaggacctctgcgttcgcgagttcgaggccctgcggagc
tgcttcgccgccgcggccaagaagaccatgatgggaggctcctag

DBGET integrated database retrieval system