KEGG   Mus musculus (mouse): 20852Help
Entry
20852             CDS       T01002                                 

Gene name
Stat6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Module
mmu_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    20852 (Stat6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20852 (Stat6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    20852 (Stat6)
   04659 Th17 cell differentiation
    20852 (Stat6)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    20852 (Stat6)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    20852 (Stat6)
  09172 Infectious diseases: Viral
   05161 Hepatitis B
    20852 (Stat6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20852 (Stat6)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    20852 (Stat6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 20852
NCBI-ProteinID: NP_033310
MGI: 103034
Ensembl: ENSMUSG00000002147
Vega: OTTMUSG00000031818
UniProt: P52633
Position
10 D3; 10 74.59 cM
AA seq 837 aa AA seqDB search
MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSAT
VQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGP
FHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQNLIDPPVNGPGPSEDLA
TMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEIMNNTVPLENSIPSNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQK
IFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNM
SQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLCSDVTMVEDSCLTQPVGGFPQGTWVSED
MYPPLMPPTEQDLTKLLLENQGEAGGSLGSQPLLQPSPYGQSGISLSHLDLRTNPSW
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggcctaatttccaagatgtccccagaaaaactgcaacggctctatgtt
gactttccacaacgcctacggcatctcctggctgactggctggagagccagccctgggag
ttcctggtcggttcagatgctttctgttacaacatggccagtgccctactttctgccaca
gtccagcgtcttcaggccactgctggagagcaggggaagggaaacagcatcttgccgcac
atcagcaccttggagagcatctatcagagggaccccctgaagctggtggccaccatcaga
caaatacttcaaggggagaaaaaagctgttatagaagagttccgccacctgccagggccc
ttccatcggaagcaggaagaactcaagtttactacagccctcggaaggcttcagcatcga
gtaagggagacccggcttctccgagaatctctgcagcaaggggctaagactggacaagtg
tctctgcagaatttgatagaccctcctgtcaatggtcctggtccaagtgaggacctggcc
accatgctgcaggggactgtgggggacctggaggccacccaggccctggtgctgaaaagg
attcagatttggaagcggcagcaacagctggcagggaatggcacaccctttgaggagagc
ctagcagggctgcaggagaggtgtgaaagcctggtggaaatttattcccagctgcagcag
gagattggggcagccagtggagaactggaacccaagacccgggcatcgctgataagccgt
ctggatgaagtcctgcgaacccttgtgaccagctctttcctggtggagaagcagcccccg
caggttctgaagacacagactaagttccaggctggggttcgattcctgctgggtctgcag
tttctagggacctcagccaagcctccaatggtcagagctgacatggtgacagagaaacag
gccagagaactaagcctggcccaggggcccgggactggagtggagagcacaggagagatc
atgaacaacacggtgcccctggagaacagcattcccagcaactgctgctccgccctgttc
aagaacctgctcctgaagaaaataaagcgctgtgagcggaagggcacagagtctgtcacc
gaggagaagtgtgctgtgctcttctccacgagcttcacattgggccccaacaaacttctc
atccagcttcaggccctgtctctgcccttggtggtcatcgtgcatggtaaccaagacaac
aacgccaaagctaccatcctatgggacaatgccttctctgagatggaccgagtgcccttt
gtggtggctgagcgagtgccctgggagaagatgtgtgaaaccctaaacctcaagtttatg
gctgaggtggggaccagccggggactgcttccagagcacttcctgttcctcgcccagaag
atcttcaacgacaacagcctcagtgtggaggcctttcagcaccgctgtgtgtcctggtca
cagttcaataaggagatcctgctgggccgaggcttcacattttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtcagatcggctgatcattggc
tttattagtaagcaatatgtcactagccttctcctcaatgagccagatgggaccttcctc
ctccgctttagcgactctgagatcgggggcatcaccattgcacacgtcatccggggtcag
gatggctcctcacagatagagaacatccagccattttctgccaaagacctgtccattcgc
tcactgggggaccggatccgggatcttgctcagttaaaaaacctctaccccaagaaaccc
aaagatgaggctttccggagtcactataagcccgaacagatggggaaggacgggaggggt
tatgtctctactactatcaagatgactgtggaaagggaccagccccttcctactccagag
ccccagatgcctgccatggtgccaccttatgatcttggaatggcccctgatgcttccatg
caactcagctcagatatggggtatcctccacagtccatccactcatttcagagcctagaa
gagtccatgagtgtactgccatcttttcaggagcctcacctgcaaatgccccccaacatg
agccagataaccatgccctttgaccagcctcacccccagggtctgctgcagtgccagtcc
caggaacatgctgtgtccagccctgaacccatgctttgctcagatgtgactatggtagag
gacagctgcctaactcagcctgtgggaggtttcccccaaggcacctgggtcagtgaagac
atgtaccctcccctgatgcctcccactgaacaggacctcaccaagcttctcctggagaac
caaggggaggcaggagggtccttaggaagccagcccctcctgcaaccatctccttatggg
caatcagggatctcactgtcccacctggacctaaggaccaaccccagctggtga

DBGET integrated database retrieval system