KEGG   Mus musculus (house mouse): 208624
Entry
208624            CDS       T01002                                 
Symbol
Alg3, D16Ertd36e, not
Name
(RefSeq) asparagine-linked glycosylation 3 (alpha-1,3-mannosyltransferase)
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    208624 (Alg3)
   00513 Various types of N-glycan biosynthesis
    208624 (Alg3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    208624 (Alg3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     208624 (Alg3)
Glycosyltransferases [BR:mmu01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   208624 (Alg3)
SSDB
Motif
Pfam: ALG3 EpsG
Other DBs
NCBI-GeneID: 208624
NCBI-ProteinID: NP_666051
MGI: 1098592
Ensembl: ENSMUSG00000033809
Vega: OTTMUSG00000025946
UniProt: Q8K2A8
Position
16:complement(20424208..20429515)
AA seq 438 aa
MAAGLRKRGQPASVGQPAGIWKQWLQRAWQERYLLLREPRYTLLVASCLCIAEVGITFWV
IHRVAYTEIDWKAYMAQVEGFINGTYDYTQLQGDTGPLVYPAGFLYIFTGLFYATDRGTD
IPMAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMA
LLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAA
LQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHRAFHLALLAAHLSL
LLLFALCRWHRTGESILALLKDPSKRKVPPQALTPNQIVSILFTSNFIGICFSRSLHYQF
YVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSFSSAALHLCHAVVLLQL
WLSPESFPKSIQPSRKTH
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggctgctgggctgcggaaacgcggccagccggcttctgtcggccagccggcaggaatc
tggaaacaatggctacagcgtgcctggcaagaacgctacctactgctgcgggaaccgcgc
tacacattgctggtggcctcctgcctctgcatagcagaggtgggcatcaccttctgggtc
attcacagggtggcatacacagagattgactggaaggcctacatggcccaggtggagggt
ttcatcaatggcacatatgactacacacagctgcagggtgacaccggacctcttgtctac
ccagctgggtttttgtacatctttacggggctattctatgctactgaccggggcactgat
atccctatggcccagaacatctttgctgtactctaccttgtcaccttggtgcttgttttc
ttgatataccaccagacctccaaggtacctcccttcgtctttttcttcatgtgttgtgcc
tcttaccgtgtccattccatctttgtactgcggctcttcaatgacccagtagctatggcc
ttgctcttcctgagcatcaaccttttcctggcacagtgctggagctggggctgctgctgt
ttcagcctggctgtctcggtgaagatgaatgtgctgctcttcgccccgggattgctattc
cttcttcttactcagtttggcttccgtggtgccctccccaagctggccatctgtgctgct
cttcaggtggtgctgggattgcccttcctgctggagaaccccattggctacctatcccgc
tcctttgaccttggtcgtcagtttcttttccaatggacagtaaactggcgcttcctgcct
gaaaccatcttcctgcatcgtgccttccatctagccctgttggctgcccaccttagcctc
ctcttgctgtttgccctctgtaggtggcacagaacaggggaaagtattctggcactgctg
aaggatccttccaaaaggaaagttccaccccaagccctcacacctaaccagattgtttcc
atcctcttcacctccaacttcattggcatctgctttagccgctcgctccactaccagttt
tatgtctggtatttccacacactgccctacctcctgtgggccatgcctgcacgctggctc
acacacctgctcaggttgctggtgctgggactcattgagctctcctggaatacgtaccca
tccacgtccttcagctctgccgccctccacctgtgccacgctgtcgtcctgctgcagctc
tggctgtcccccgagtccttccctaagagcattcagccaagcaggaaaactcactga

DBGET integrated database retrieval system