KEGG   Mus musculus (mouse): 208628
Entry
208628            CDS       T01002                                 

Gene name
Kntc1, D330012D13, jg, jgl
Definition
(RefSeq) kinetochore associated 1
  KO
K11577  kinetochore-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    208628 (Kntc1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     RZZ complex
      208628 (Kntc1)
SSDB
Motif
Pfam: Rod_C RPN13_C MRP-S22
Other DBs
NCBI-GeneID: 208628
NCBI-ProteinID: NP_001035886
MGI: 2673709
Ensembl: ENSMUSG00000029414
Vega: OTTMUSG00000054741
UniProt: Q8C3Y4
Position
5; 5 F
AA seq 2207 aa
MWNNIELLTSDDTGSGCLSVGSRKENVTALYQADLLGKISSEKTSLSPKIQAFSLSHGFI
IVADQSVILLDSICRSLQLFLIFDTDVDVVGLCQEGKFLFVGERSGNFHLIYVTSKQTLF
TKAFVEKALDESQRTYRNLIIEKDGSNEGTYYMLLLTNNGFFYITNLQLSQIEQAIENTD
LDSAKKLQGQFKCSFISTENYHSCLSLVASQSGTFASKTSVIIGGTGSCAFSKWEPDSTK
KEMSLKNFVGTDIIKGAKSFQLIDNLLFVLDTDNVLSLWDAYTLTPVWNWPSLPVEQFVL
TTEADSPSSVTWQGITNLKLVTLTATAKEKMRSLIIYSLPSMETLYSLEVSSVSSLVQTG
ISTDTIYLLEGIHKNDPNLCEDSVSDLVLRYLTEVLPENRLSRLLHKHRFAEAESFAIQF
GLDVELVYKVKSNDMLEKLALISSDKSEQSKWQQLVDEAKENLCKIQDDDFVVNFCLKAQ
WVTYETTQEMLSYAKTRLMKKEDRALPASSDAFMEVLKAHAKLTTFYGAFGPEKFSGSSW
IEFLNNEDDLRDVFLQLSEGNFACAQYLWLRHRADFESKFDVKMLENLLNSISTQFPLEN
LCSWFKNEVIPFVRRIVPEGQNILAKWLEQASRNLELTDKANWPENGLQLAEVFFTAEKT
DRFGFASSWHWISLDYQNTEEVRQLRTLVSKLRELIILHRKYNCKLALSDFEKENATTVV
FRMFDRVSAPELIPSVLEKSVRVYIREQNLQEEELLLLYIEDLLKRCSSKSMTLFDTAWE
AKAMAVIRCLSDTDLIFDAVLKIMYKAVVPWSAAVEQLVKQHLEMDHPKVKLLQESYKLM
EMKKLLRGYGIREVNLLNKEIMRVIRYILKQDIPSSLEDALKVAQGYRLSDDEIYSLRII
DLIDREQGGDCLLLLKSLPAAEAEKTAERVIIWARLALQEEPDGSEEDKAWRISVAKTSV
DILKILCDIRKDNLQKKDESEEFLKRFQMVASLQENFEVFLPFEDYSNTALVAGLREQYI
KAQEAAQAEHKHRGPPGPTPARGTHLSIKSKLHRQALALQVSEQELEAELTLRALKDGKV
VAALSKCRDLLKHYCNADTGRLLFVVCQKLCQMLADDVPMVAPGGLSLPSEIHDLACHAV
TICSPDYLLDVLELSKYTLTAVELCRQCQMDDCGMLMKAALGTHKDPYEEWSFSDFFSED
GIVLESQVVLPVIYELISSVMPPAESKRHPLDSISLPYCSTSEGENRILPLVSSISALLR
SLQECSQWELALRFVVGSFGTCLQHSMSNVMSISLSKQLLGKNTLANSRHIIMELKEKSI
TFIRENATTLLHKVFNCRVVDLDLALAYCTLLPQKDVFDNLWKFIDKAWQNYDKILALSL
VGSQLANLYQDIETGLWFHELSIDAKWGIRLGKLGISFQPAFRQNFLTKKDLIKALVNNI
DMDTSLILEYCSTFQLDSDAALRLFIETLLRNTSSQSQGDAAPESTKHQHSKLLAKATEL
VPLLKNTKDLVISLSEILYKLDPYDYEMIDVVLKVLEQANEKITSVNINQALNLLRHLKS
YRRISPPVDHEYQYALEHMITLPPAAHTRLPFHLILFGTAQNFWKILSSELSEESLPTLL
LIAKLMKFSLDTLYVSTAKHLFEKNLKPKLLKSAQARSSTLMSKEVDKLMQTLESYLLSI
VNPEWAVAIAISLTQEVPEGPFKMSSLKFCLYLAERWLQNIPPQDETCEKAKALQKKLCL
QVRLSGTEAVLIAHKLNDQEYLRVIGKPAHLIVSLYEHPSISERLCTTSGKDYPDIHTAA
KEIAEVNEVNLEKIWDMLLEKWLCPSTVPSEKASEFFELEEDEVLHRVVYLLQARPVDYC
SRMLFVFATSATSTLGMRQLTFAHKARALQCLLYLADKETIESLFKKPIKEMKSYLKCIT
FLASFETLNIPITYELFCNSPKEGMIKGLWKNHSHEPMAVRLVAELCLEYKIYDLQLWNG
LLQKLLGFNMIPYLRKVLSCISSIHSLWQVPYFSKAWQRVIQIPLLSASCPLRPSQLADC
CDSLVAILECPVSDDLDMMGVAKQYVQLDLPAFALTCLTLMPHSEKRHQQIKNFLNSCDA
RIILQQIEEHMNTGQLAGFSHQIGSLVLNHVVNKKEFGILAKTKYFQLLKCHVINTGNVT
ELVNYLANDFSVDEASALINEYSKHCGKPVPADAAPCEILQTFLGGS
NT seq 6624 nt   +upstreamnt  +downstreamnt
atgtggaacaatattgagctgctaacaagcgatgacactggaagtggatgcctgagtgtt
ggctcaagaaaagaaaacgtgactgcactgtaccaagccgacttgcttgggaagatctcc
tctgagaagacctcactgagtccgaagatccaagcattcagcttaagccatgggtttata
atcgttgcagaccagtcagtgatattgcttgacagtatatgcagatcactccagttgttt
cttatcttcgatactgacgtggatgtggtcggcctgtgtcaagaaggaaagtttctcttt
gtgggggagagaagcggcaacttccaccttatctacgtcacatcgaagcaaacgctgttc
accaaggcttttgtggagaaagctttggacgagagtcagcgaacgtaccggaatctcatt
attgagaaagatggttcaaatgaaggtacctattatatgttgcttctaacgaacaatgga
tttttttatattacaaacctccagctttcacaaattgaacaggccattgagaacacggac
ttggattcagccaagaagttacaaggacaattcaaatgtagttttatttctactgaaaat
taccacagttgtctcagtcttgtggcatctcaatctggaacatttgcaagtaaaacttct
gtgataattgggggaaccggtagttgtgcattctcaaaatgggaacccgattctaccaag
aaagaaatgtctcttaagaactttgtgggcacagacattattaaaggtgcaaagtcattt
cagctgatcgacaacctgctttttgtgctggatactgataatgtgctgagcttgtgggat
gcttacactctcactcctgtgtggaactggccctctcttcccgtagagcagtttgttctc
acgacagaagcggattctccctcatctgttacctggcaaggaattacaaatctcaaatta
gtcaccctgacagcaacagcgaaggagaagatgagaagcctcatcatttactctctgcct
tcgatggaaacactgtactctttggaagtatctagtgtttcttctttagttcaaacagga
atcagcacggacactatatatcttctggaaggaattcacaaaaatgatcctaacctatgt
gaagactctgtgtctgacttagtacttaggtacctcacagaggtgttaccagaaaacaga
ctgagccggttacttcacaagcacagatttgccgaagccgagagctttgccattcagttc
ggactggatgttgagcttgtttataaggtcaaatcaaatgatatgttggagaagctggct
ttgatttcctcggacaagagtgagcagtccaaatggcagcaacttgtagatgaagctaaa
gaaaacctatgcaaaatccaggacgatgacttcgtggtgaatttctgcctcaaggcccaa
tgggtaacctatgaaaccacccaggaaatgctcagttatgccaaaaccaggctcatgaag
aaagaagacagagctctacctgcctcttctgatgccttcatggaggtgctaaaagctcat
gcaaagttaactacattttatggagcatttggaccagaaaaattcagtggtagctcttgg
attgagttcctgaataacgaagatgacctcagggatgtttttttgcagctaagtgaagga
aacttcgcttgtgctcagtatctttggcttagacatcgggctgactttgaaagcaagttt
gacgtgaaaatgctggagaatttgctgaattcaatatctacacaattccccttggaaaac
ctttgttcctggtttaaaaatgaagtgattccgtttgtgaggaggattgtgcccgaagga
caaaacattcttgcaaaatggctagaacaagcatcaaggaacctagagttaactgataag
gcaaactggccagaaaatggacttcagctggcagaggtgttcttcactgcagaaaaaaca
gaccggtttggattcgcatcttcttggcactggatttccttggattatcaaaacacagag
gaagtccgccagttacggacactggtgagcaagttgcgggagctgatcattctgcatagg
aaatacaactgcaagctggccctctcggactttgagaaggaaaatgccaccactgtggtg
ttccgcatgttcgacagggtctcggccccagagctgatcccttcggtcttagagaagtct
gtgagagtttacattcgcgaacagaatctgcaagaggaggagctgctgttgctctatata
gaggatttactgaagaggtgtagctcaaagtcaatgactctcttcgacacagcgtgggaa
gcaaaggccatggccgtgataagatgcttgtctgacacagatctcatctttgatgctgtg
ctgaagataatgtacaaggcggtggttccctggagtgcagccgtggagcagctggtgaaa
cagcacctggaaatggaccaccccaaagtcaagttattgcaggaaagctacaaactgatg
gagatgaagaaacttttgcgagggtatgggataagagaggtgaatctcctgaacaaggaa
ataatgagagtgatccgatacattctaaagcaggacatcccgtcttctttagaagatgct
ctgaaggtggcccaggggtacaggctgtctgatgacgaaatctacagcctgagaatcatc
gatctgattgacagggagcaggggggagattgcctcctgctactgaagtctctgcctgcc
gctgaagccgagaagactgcagaaagggttatcatctgggctcgactggcactgcaggag
gagcctgacggctctgaggaggacaaggcctggagaatatctgtggcgaagacatcggtg
gatattctcaagatcctgtgtgatattcgaaaagacaatctgcagaagaaggatgaatct
gaagaattcctgaagcgatttcaaatggttgctagtttacaggagaactttgaggtcttc
cttccatttgaagactacagcaacaccgccttggtagctggccttcgagaacagtatatt
aaggcacaggaagctgcacaggctgagcacaaacacaggggaccccccgggcccaccccg
gctagggggacacacctgagcatcaagtcaaagctgcaccgacaggcactggccctgcag
gtgtctgaacaggagctggaggcagagctgaccttgagagccttaaaggacgggaaggtg
gtggccgccctgagcaaatgcagagatttacttaagcattactgcaatgccgacactggg
aggttactgtttgtggtgtgtcagaagctctgtcagatgttggctgacgatgtcccaatg
gtggccccaggaggactcagccttccttctgagatccatgacctcgcatgccacgctgtc
accatctgcagtccagattatttgctggatgttttagaactaagtaaatacactttaacc
gctgtggagctttgcagacaatgccagatggatgactgtggaatgctgatgaaggccgct
cttggaactcacaaggatccctatgaagagtggtcctttagtgacttcttcagtgaagat
ggaattgttctcgagtcccaggtggtgctgcctgtcatctatgaattgatctcatcagtg
atgccccctgcagaaagcaaaagacatcctttggattctataagtttgccatactgctcc
actagtgaaggagaaaaccgtattctccctcttgtaagctccatctctgctctgctccgg
agcctccaggaatgtagtcagtgggagctagccctgaggttcgtggtgggctcctttggt
acctgcctgcagcactctatgtcaaacgtcatgagtatcagcttgagtaaacagttactt
gggaagaacacattggcgaactccaggcatatcattatggaattgaaagagaagtccatc
acatttatcagagaaaatgctacgacactcctgcataaagtgtttaactgtcgggtggtg
gatctggacctcgccttggcttactgcactctcttacctcaaaaggatgtattcgacaac
ctctggaagttcatagataaagcgtggcagaattacgacaaaattctggcattatctttg
gtgggctctcagctggcaaatctctaccaggatattgaaacaggactttggttccacgag
ctcagtatcgatgccaagtggggtattcgtcttggtaaacttggtatttcttttcagcct
gcttttagacaaaattttctcaccaagaaagaccttatcaaagctcttgtgaataacata
gacatggacaccagcctcattctggagtattgcagcacatttcagctggactctgacgct
gcccttcggctgttcattgaaactctgctccgcaacactagcagccagagccagggagat
gctgccccggagtccacaaagcatcagcattccaaactcctggcgaaagccactgagctg
gtccctttactgaagaacacaaaggatctggtgatcagtcttagtgagatcctctataag
ctggacccatatgattatgaaatgattgatgttgtcctgaaagttttagaacaagctaac
gaaaagataaccagtgtgaacatcaatcaggcgctgaatcttctgagacacttgaagtca
tacagaaggatctccccgccagtggaccacgaataccagtacgcgctggagcacatgatc
actctgccaccggctgctcacactagactgccctttcacctaatactgtttggcacagca
cagaacttctggaaaattctctcctcagagctcagcgaagagtcgctgccaaccctgctc
ttaatcgcgaagctgatgaagttctccctagatactctctatgtgtctaccgccaaacac
ttgtttgaaaaaaacctgaagccaaagctcctgaagtcggcacaagccaggtcctccacc
ctgatgagcaaggaagtggataagctcatgcagacgctggagtcgtacctcctgtccatc
gtcaaccccgagtgggctgtcgccattgccatcagcctcacccaggaagtcccagaaggc
cccttcaagatgtctagtttgaagttctgcctgtatttagctgagagatggctacaaaac
atcccacctcaggatgagacgtgtgaaaaggccaaagccttgcagaagaagctctgcctc
caggtccggctctcaggaacggaagccgtgctcatagcccacaagctgaacgatcaggaa
tatttaagagtgatagggaagccagcgcacctcatcgtgagcctctacgaacatcccagc
ataagcgaaaggctttgtaccacatctggcaaagattatcccgatatccatacagccgct
aaagaaatagccgaagtcaatgaagttaatttggaaaaaatctgggacatgttgttggag
aaatggctgtgcccctcaacggtgcccagtgagaaagcatcggagttctttgagctggaa
gaggatgaagtgctgcatagagtcgtgtatctcctccaggctcgtcctgttgattattgt
tcgagaatgctgtttgtatttgccacttcagctacaagtacactgggcatgcgccagcta
acgtttgcccacaaagcacgagctctgcagtgtctcctctatttggctgacaaggaaaca
attgaatctctcttcaaaaagcccattaaagaaatgaaatcctatctgaaatgtataact
ttcctggcatcatttgagacattgaatattcccatcacatatgaattattctgcaacagt
cccaaagaaggcatgattaagggcttgtggaagaaccacagccacgaacctatggcagta
cgattggttgcagagctttgcttagaatacaaaatctatgacctgcagctttggaatggg
ctcttgcagaagcttctgggcttcaacatgattccttacctgaggaaagtgttatcctgc
atttctagcatccattcgttatggcaggtgccctacttcagcaaagcgtggcagcgcgtg
atccagatccctctgctctcggcttcctgtcctttaagacccagtcagttagcagactgc
tgtgacagtctcgtcgccatccttgaatgtccagtttcagatgacctggacatgatggga
gtcgccaagcagtacgtccagttagaccttcccgcttttgctctgacctgcctgacgctc
atgccccactctgaaaaaagacaccagcagatcaagaattttctgaattcctgtgatgct
cggatcattttacagcagatagaagaacatatgaacactggccagctagcagggttttca
catcagattggaagtctggttctgaatcatgttgtaaataagaaggaatttgggattttg
gcaaagacaaagtattttcagttgttgaaatgccacgtgataaacaccggcaacgtcact
gaattggtaaactatttggcaaatgacttcagtgtagatgaagcatcagcgttgataaat
gagtattcaaagcattgtgggaagcctgtgccagcagatgcagctccctgtgagatcctg
cagacatttcttggtggatcatag

DBGET integrated database retrieval system