KEGG   Mus musculus (mouse): 208638Help
Entry
208638            CDS       T01002                                 

Gene name
Slc25a38, AV019094, BC010801, appoptosin
Definition
(RefSeq) solute carrier family 25, member 38
  KO
K15118  solute carrier family 25, member 38
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    208638 (Slc25a38)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   208638 (Slc25a38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 208638
NCBI-ProteinID: NP_659042
MGI: 2384782
Ensembl: ENSMUSG00000032519
Vega: OTTMUSG00000033822
UniProt: Q91XD8
Position
9; 9 F4
AA seq 326 aa AA seqDB search
MGVSAEPRSLSVAGAGLASPVIEKARSALLQSQDVEDTVETLMLHPVIKAFLCGSISGTC
STLLFQPLDLLKTRLQALQPSDLGPRRVGMLAVFLKVVRTESLLGLWKGMSPSIVRCVPG
VGIYFGTLYSSKQYFLRGHPPTALESVILGMGSRSVAGVCMSPITVIKTRYESGTYSYES
IYAALRSIYCSEGHRGLFRGLTATLLRDAPFSGLYLMFYSQTRTAVLHGTAQLDAALIPL
INFSCGIFAGVLASLVTQPADVIKTHMQLSPVKFQWIGQAATLIFKNHGLRGFFHGSVPR
ALRRTLMAAMAWTVYEEMMARMGLKS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgagcgcggagccccggagcctctcagtcgccggggccgggctcgcgtcccca
gtgatcgagaaggcacgctcggcgctgctgcagtcgcaggatgtagaggacacggtggag
acgctcatgttacacccagtgattaaggctttcctctgcggctccatcagcgggacctgt
tccacgctcctcttccagcctttggatctcctcaaaacccgtctgcaggccctgcagccc
tcagacctagggcccagacgtgttgggatgttggctgtgttcttgaaggtggttcgcaca
gaaagtctcctgggcctttggaaagggatgtctccttccattgtgagatgtgtccctgga
gtggggatctactttggcaccctgtattcttcgaagcagtatttcttgcgaggccatcct
cccaccgccctggagtcggtcatcctgggcatgggctcccgctctgtggcaggagtctgc
atgtcacccatcacagtgatcaagacacgctatgagagtgggacttacagctatgagagc
atctatgcagccctgaggagcatctactgcagcgagggccaccgtggcctcttcaggggc
ctgacagcaactctcctccgtgatgcccccttctcagggctctacctgatgttttacagt
cagaccaggaccgcagtgctgcacggcacagcccagctggatgctgctctgatacccctt
attaatttctcctgtgggatatttgctggcgttctggcttcactggtgactcaacctgca
gacgtgatcaaaactcacatgcagctctccccagtgaagtttcagtggattggccaagca
gccactctcatcttcaagaaccatgggctgcgtggcttctttcatggcagtgttccccga
gccctccgaagaacgctgatggctgccatggcgtggaccgtctatgaagagatgatggcc
aggatgggcctgaagtcctga

DBGET integrated database retrieval system