KEGG   Mus musculus (house mouse): 208643
Entry
208643            CDS       T01002                                 
Symbol
Eif4g1, E030015G23Rik, eIF-4-gamma_1, eIF-4G_1, eIF-4G1, eIF4GI
Name
(RefSeq) eukaryotic translation initiation factor 4, gamma 1
  KO
K03260  translation initiation factor 4G
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    208643 (Eif4g1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    208643 (Eif4g1)
   03012 Translation factors [BR:mmu03012]
    208643 (Eif4g1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     208643 (Eif4g1)
   mRNA cycle factors
    Stress granule specific factors
     208643 (Eif4g1)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    208643 (Eif4g1)
SSDB
Motif
Pfam: MIF4G MA3 W2
Other DBs
NCBI-GeneID: 208643
NCBI-ProteinID: NP_666053
MGI: 2384784
Ensembl: ENSMUSG00000045983
UniProt: Q6NZJ6
Position
16:20491446..20511633
AA seq 1600 aa
MNKAPQPTGPPPARSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQGGFRSLQHFYP
SRAQPPSSAASRVQSAAPARPGPAPHVYPAGSQVMMIPSQISYSASQGAYYIPGQGRSTY
VVPTQQYPVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPASVAPAPVLMNQPPQIAP
KRERKTIRIRDPNQGGKDITEEIMSGARTASTPTPPQTGGSLEPQPNGESPQVAVIIRPD
DRSQGAAIGGRPGLPGPEHSPGTESQPSSPSPTPSPPPILEPGSESNLGVLSIPGDTMTT
GMIPMSVEESTPISCETGEPYCLSPEPTLAEPILEVEVTLSKPIPESEFSSSPLQVSTAL
VPHKVETHEPNGVIPSEDLEPEVESSTEPAPPPLSPCASESLVPIAPTAQPEELLNGAPS
PPAVDLSPVSEPEEQAKKVSSAALASILSPAPPVAPSDTSPAQEEEMEEDDDDEEGGEAE
SEKGGEDVPLDSTPVPAQLSQNLEVAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKE
VDPAVPEVENQPPTGSNPSPESEGSMVPTQPEETEETWDSKEDKIHNAENIQPGEQKYEY
KSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHITDVVLDKANKTPLRQLDPSR
LPGINCGPDFTPSFANLGRPALSNRGPPRGGPGGELPRGPAGLGPRRSQQGPRKETRKII
SSVIMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMF
QQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVT
VNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSL
GNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFAKAKPRMD
QYFNQMEKIIKEKKTSSRIRFMLQDVLDLRQSNWVPRRGDQGPKTIDQIHKEAEMEEHRE
HIKVQQLMAKGSDKRRGGPPGPPINRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPG
SIDSNNQLFAPGGRLSWGKGSSGGSGAKPSDTASEATRPATLNRFSALQQTLPAENTDNR
RVVQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERP
SQPEGLRKAASLTEDRGRDPVKREATLPPVSPPKAALSVDEVEKKSKAIIEEYLHLNDMK
EAVQCVQELASPSLLFIFVRLGIESTLERSTIAREHMGRLLHQLLCAGHLSTAQYYQGLY
ETLELAEDMEIDIPHVWLYLAELITPILQEDGVPMGELFREITKPLRPMGKATSLLLEIL
GLLCKSMGPKKVGMLWREAGLSWREFLAEGQDVGSFVAEKKVEYTLGEESEAPGQRTLAF
EELRRQLEKLLKDGGSNQRVFDWIDANLNEQQIASNTLVRALMTTVCYSAIIFETPLRVD
VQVLKVRARLLQKYLCDEQKELQALYALQALVVTLEQPANLLRMFFDALYDEDVVKEDAF
YSWESSKDPAEQQGKGVALKSVTAFFNWLREAEDEESDHN
NT seq 4803 nt   +upstreamnt  +downstreamnt
atgaacaaagctccccagcccacaggccccccacccgccaggtcccctggactcccacag
ccagcgtttcccccggggcagactgcaccggtggtgtttagcacgcctcaagcgacacaa
atgaacacgccttctcagccccgccagggaggattcaggtctctgcagcacttctaccct
agccgggcccagccccctagcagtgcagcctcccgagtgcagagtgcagcccctgcccgt
cctggcccagctccccatgtctaccctgctggatcccaagtaatgatgatcccttcccag
atctcctactcagcctcccaaggagcctactatatccctggacaggggcgttccacatat
gttgtcccaacacagcagtaccctgtgcagccaggagccccaggcttctatccaggtgca
agccctaccgagtttgggacctatgctggagcctattacccagcccaaggtgtgcagcag
tttcctgctagtgtggctcctgccccagttttgatgaaccagccaccccagattgctcct
aagagggaacggaaaactatccgaattcgagacccaaaccaaggagggaaggatatcaca
gaagagatcatgtctggggcccgcactgcctccacacccactcctccccagacgggaggc
agtctggagcctcaacccaatggggagtcgcctcaggttgctgtcattatccggccagat
gaccggtcgcagggagcagccattggggggcggccaggactgcctggcccagagcatagc
cctggcacagaatctcagccttcgtcgccttctccaaccccatcaccacccccaattttg
gagccggggtctgagtctaatcttggagtcctctctattcctggggacactatgacaaca
gggatgataccaatgtctgtagaagaatcgacccctatctcttgtgaaactggggagccg
tattgcctctctccagaacccactcttgccgaacccatactggaagtagaagtgacactc
agcaaacccattccagaatctgagttctcttccagtcctctccaggtttccacggccctg
gtgcctcacaaggttgaaactcatgagcccaatggcgtgatcccatctgaggatctggaa
ccagaggtggagtcaagcacagagccagctcctccccctctatcaccttgtgcttctgaa
tcgctcgtgcccattgctccaactgcccagcctgaggaactgctcaacggagccccctca
ccaccagctgtggatttaagcccagtcagtgagccagaggaacaggccaagaaggtttca
tcagcagcactggccagcattctctctcctgctccacctgtggctccttcagatacttct
cctgctcaggaggaagaaatggaagaagatgacgatgacgaagaaggtggagaagctgag
agtgagaagggaggagaggacgtcccccttgacagtactcctgtcccagcccagctgtct
cagaatttagaggtggcagcagctacccaggtggcagtgtctgtgccaaagaggagacgg
aaaattaaagagctaaataagaaggaggctgtaggagaccttctagatgccttcaaggag
gtggacccagcagtaccagaggtagagaatcagcctcccactggcagcaacccaagccca
gagtctgagggcagcatggtgcccacacagcctgaggaaacagaagaaacctgggactct
aaggaagacaaaattcataatgctgagaacatccagcctggggagcagaagtatgagtac
aagtcagatcagtggaagcctctaaaccttgaagaaaagaagcgttatgacagagaattc
ctgctgggctttcagttcatctttgccagcatgcagaagccagaaggattgccccatatc
actgatgtggtgctggacaaggccaataaaacaccacttcggcaactggatccctccaga
ctacctggcataaactgtggcccagatttcactccatcttttgccaatcttggccgacca
gccctcagcaaccgtgggcccccgaggggtgggccaggtggggagctgccccgagggccg
gctggcctgggacccaggcgctctcagcagggcccacgaaaggaaactcgcaagatcatt
tcctcagtgataatgactgaagacataaaactaaataaagcagagaaggcttggaaaccc
agtagcaaacggacagcagctgataaggatcgaggggaagaggatgctgatggaagcaag
acccaggacctgttccgcagggtacgctccatcctgaataagctgacaccccagatgttt
cagcagctgatgaagcaggtgacacagctggccattgacacggaggaacgcctcaaagga
gttattgacctcatctttgagaaagccatttcagagcccaacttctctgtggcttatgcc
aacatgtgccgctgcctcatggcgctgaaagtgcccactacagaaaagccaacagtaact
gtgaattttcgaaaactgttgttaaatcggtgccagaaggaatttgagaaagacaaagat
gatgatgaagtttttgaaaaaaagcaaaaagagatggatgaagctgctacggcagaagaa
cggggacgcctgaaagaagagctagaagaagcccgggacatagctaggcggcgctcttta
gggaatatcaagtttattggagagttattcaagttgaagatgttaacagaagcaataatg
catgactgtgtggtcaagctacttaagaaccatgatgaggagtccctggaatgcctctgc
cgcctcctcaccactataggcaaagacctggactttgcaaaagccaagcctcgaatggat
cagtatttcaaccaaatggaaaaaatcattaaagaaaagaagacctcatctcgcatccgt
tttatgctgcaggatgtactcgatctgcggcagagtaattgggtgccacgccgaggggat
cagggtcctaagactattgatcaaattcacaaggaggctgagatggaagagcaccgagaa
catattaaagtacagcagctcatggccaagggcagcgacaaacgtcggggtggccctcca
ggcccgcctatcaaccgtggccttccacttgtagatgatggtggctggaatacagtcccc
attagcaaaggcagtcgccccattgacacctcacggctcaccaagatcacaaagcctggt
tccattgattctaacaaccagctttttgcacctggaggacgactgagttggggcaagggc
agcagtgggggctcaggagccaagccctcagacacagcatcggaagctactcgtccagct
accttgaatcgcttttctgctcttcaacaaacattacccgcagagaacacagataacaga
cgtgttgtacagaggagtagcttgagccgggaacgaggtgagaaagctggggaccgggga
gaccgactagagcggagtgagcggggaggtgaccgtggggaccgacttgatcgtgccaga
acacctgccaccaagcgaagttttagcaaagaagtggaggagcgaagtagagagcggcca
tcccagcctgagggactccgcaaggcagctagcctcacagaggatcgtggtcgggatcct
gtgaagcgggaagccactctacctccagtgagccctccaaaggctgcgctgtctgtggat
gaggtggagaagaaatctaaggccatcattgaggaatatctccatctcaatgacatgaag
gaggcagtacagtgtgtccaggagctggcttcaccctccttgctcttcatcttcgtacgg
cttggtatcgagtccacgctggagcgtagtaccattgctcgtgagcatatggggcgacta
ctgcaccaactgctctgtgcggggcacctctctactgcccagtactatcaagggctgtat
gaaacactagaattggctgaggacatggaaattgatatccctcatgtatggctttacctg
gcagaactgattacacctattctccaggaagatggggtgcccatgggagagctcttcagg
gaaattacgaagcctctgagacccatgggcaaagctacttctttattgctggagatcctg
ggtctcttatgcaagagcatgggtcccaaaaaggtggggatgctgtggcgagaggctggg
ctgagctggagggaatttctagcagagggccaagacgttggctcatttgtggctgaaaag
aaggtggaatataccttgggagaagaatctgaagctcctggccagaggacacttgccttt
gaggagcttcgtaggcagctagagaagctgctgaaggacggcggcagtaatcagcgtgtg
ttcgactggatagacgccaacctaaatgagcagcagatagcatccaatacattagttcga
gccctcatgacaactgtctgttattctgcaattatctttgagactcctctccgagtggat
gttcaagtgttgaaagtgcgagcaagactgctgcagaaatacctgtgtgatgagcagaag
gagctacaagcactctatgctctccaggcccttgtagtgaccttagaacagcctgccaac
ctgcttcggatgttctttgatgctctatatgatgaggacgtggtgaaggaagacgccttc
tacagctgggagagcagcaaggatcctgctgaacagcagggcaagggtgtggcccttaaa
tctgtcacagcattcttcaattggcttcgtgaggctgaggacgaggagtctgatcacaac
tga

DBGET integrated database retrieval system