KEGG   Mus musculus (mouse): 208650
Entry
208650            CDS       T01002                                 

Gene name
Cblb, AI429560, AI851073, Cbl-, Cbl-b
Definition
(RefSeq) Casitas B-lineage lymphoma b
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04910  Insulin signaling pathway
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    208650 (Cblb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    208650 (Cblb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    208650 (Cblb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    208650 (Cblb)
   04660 T cell receptor signaling pathway
    208650 (Cblb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    208650 (Cblb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    208650 (Cblb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    208650 (Cblb)
   04121 Ubiquitin system [BR:mmu04121]
    208650 (Cblb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     208650 (Cblb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    208650 (Cblb)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    208650 (Cblb)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 zf-RING_5 zf-rbx1 UBA zf-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 208650
NCBI-ProteinID: NP_001028410
MGI: 2146430
Ensembl: ENSMUSG00000022637
UniProt: Q3TTA7 B9EKI5
Structure
PDB: 
5AXI

Position
16; 16 B5
AA seq 938 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFSIPMLDLDDDDDREESLMMNRLASVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPERPPPIPPDNRLSRHFHHGESVPSRDQPMPLEAWCPRDAFGT
NQVMGCRILGDGSPKPGVTANSSLNGRHSRMGSEQVLMRKHRRHDLPSEGAKVFSNGHLA
TEEYDVPPRLSPPPPVTTLLPSIKCTGPLANCLSEKTRDTVEDDDDEYKIPSSHPVSLNS
QPSHCHNVKAPVRSCDNGHCILNGTHGAPSEMKKSNIPDLGIYLKGEDAFDALPPSLPPP
PPPARHSLIEHSKPPGSSSRPSSGQDLFLLPSDPFFDPTSGQVPLPPARRAAGDSGKANR
ASQDYDQLPSSSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGY
AFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRLNL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaatcctggtggtcgaggaggaaacccccgcaaaggt
cgcattttggggattattgatgctattcaggatgcagtcggacccccaaagcaagctgca
gctgaccgcaggactgtggagaagacttggaaactcatggacaaagtggtaagactgtgc
caaaatcccaagcttcagttgaaaaacagcccaccgtatatacttgatattttacctgat
acgtatcagcacttgagacttatattgagtaaatatgatgacaaccagaagctggctcaa
ctgagcgagaatgagtactttaaaatctacatcgatagtctcatgaagaagtcgaagcga
gcgatccggctctttaaagaaggcaaggaaaggatgtacgaagagcagtcgcaggacaga
cggaatctcacaaagctgtcccttatcttcagtcacatgctggcagaaatcaaggcgatc
tttcccaatggccagttccagggagataacttccggatcaccaaagcagatgctgctgag
ttctggaggaagttttttggagacaaaactattgtaccatggaaagtcttcagacagtgc
ctgcatgaggtccatcagatcagctctggcctggaagcaatggctctgaagtcaaccatt
gatttaacttgcaatgattacatctcagtgtttgaatttgatatttttaccaggctattt
cagccctggggctctattttacggaattggaacttcttggctgtgactcacccgggatac
atggcatttctcacgtatgatgaagttaaagctcggctacagaaatacagcaccaagcct
ggaagttacattttccggttaagctgcactcggctgggacaatgggccattggctatgtg
actggggacggcaatatcctacagaccatacctcataacaagcccctgttccaagccctg
attgatggtagcagggaaggcttttatctttatcctgatgggcggagctataaccctgat
ttaaccggattatgtgaacctacacctcacgatcatataaaagttacacaggagcagtat
gaactgtattgtgaaatgggctccacttttcagctctgcaagatctgtgcagagaatgac
aaagatgtcaagattgagccttgcgggcatctgatgtgcacttcgtgccttaccgcgtgg
caggagtctgatggccaaggctgccccttctgtcgctgtgagataaaaggaacggagccc
atcattgtggaccccttcgaccccagagatgaaggctccaggtgctgcagcatcattgac
cctttcagcatccccatgcttgacttggacgatgacgatgatcgagaggagtctttgatg
atgaacaggctggcgagtgttcgaaagtgcacggacaggcagaactcaccagtcacatcg
ccaggctcctcaccccttgcccagagaagaaagcctcagccagaccctctccagatcccc
cacctcagcctgccaccagtgcctccccgcctagatctcattcagaaaggcatcgtgcgc
tctccgtgtggcagccccacaggctcgccaaagtcttctccatgcatggttagaaaacaa
gacaaaccactcccggcaccccctcctcccttgagagatccacctcctccaccagagagg
cctccccccatcccacctgacaatagactgagcagacacttccaccatggagagagtgtg
ccttcccgggaccagcccatgcccctcgaagcctggtgccctcgggatgccttcgggact
aaccaggtgatgggatgtcgcatcctcggggatggctctccaaagcctggcgtcaccgca
aactccagcttaaatgggaggcacagtagaatgggctccgagcaggttcttatgaggaaa
cacagacgccatgatttgccttcagaaggagccaaggtcttttccaatggccaccttgcc
actgaagaatacgatgtccctcctcggctttcccctccgcctccagtcaccacccttctc
ccaagcataaagtgtactggtccattagcaaattgtctctcagagaaaactagagacacg
gtagaagatgatgacgatgaatacaagattccttcatcccatcctgtgtccctgaattca
caaccatctcattgccataatgtcaaagctcctgttcggtcttgtgataatggtcattgt
atattgaatggaactcatggtgcgccttcagagatgaagaaatcgaacatcccagattta
ggcatctatttgaagggtgaggacgcctttgatgctctccctccatccctccctcctccc
ccacctcctgcaagacacagtctcatcgaacattcaaaacctccaggctccagtagccgg
ccttcctcagggcaggaccttttccttcttccttcagatcccttttttgacccaacaagt
ggccaagttccattgcctcctgccaggagagcagcaggagacagcggcaaagccaacaga
gcctcgcaggactatgaccagctcccttcatcttccgatggttcgcaagcaccagctaga
ccccccaaaccacgaccccgaaggactgcaccagaaattcatcacagaaagccccatggg
cccgaagcggcgttggaaaatgtcgatgcaaaaattgcaaaactcatgggagaggggtat
gcctttgaagaggtgaagagagccttagagattgcccagaataacgtggaagtggccagg
agcatacttcgagaatttgccttcccccctcctgtctccccacgtctgaatctatag

DBGET integrated database retrieval system