KEGG   Mus musculus (house mouse): 20871
Entry
20871             CDS       T01002                                 
Symbol
Aurkc, AIE1, AIK3, ARK-3, IAK3, Stk13
Name
(RefSeq) aurora kinase C
  KO
K11480  aurora kinase C [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20871 (Aurkc)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20871 (Aurkc)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20871 (Aurkc)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   20871 (Aurkc)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     20871 (Aurkc)
  Sister chromatid separation proteins
   Aurora kinases
    20871 (Aurkc)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Kdo YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 20871
NCBI-ProteinID: NP_001074435
MGI: 1321119
Ensembl: ENSMUSG00000070837
UniProt: O88445 Q497X5
Position
7:6998346..7006090
AA seq 276 aa
MEPSTSTRKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQ
LRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATII
QELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLP
PEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQ
DLISKLLRYHPSERLSLAQVLKHPWVREHSRRVLPC
NT seq 831 nt   +upstreamnt  +downstreamnt
atggagcccagcacctcaaccaggaagcatttcaccatcaatgactttgaaatcgggcgt
cctctgggcagggggaaatttgggcgtgtgtacttggctcggctcaaggaaaatcatttc
atcgtggccctgaaggtcctcttcaagtctgagatagagaaggagggattggagcaccaa
cttcgcagggaagtggagatccaggcacacctacaacaccggaacatccttcgcctgtac
aactacttctatgatgacactcggatatacttaattctggagtatgctccaggaggagag
ctctataaggagcttcagagacatcagaagttggaccagcagcgtacagccacgataata
caggagttgtcagatgccctgacctactgccatgagaagaaggtgattcacagggacatc
aagccagagaatctcctgctgggcctcaatggtgaggtgaagatctcagactttgggtgg
tctgtgcataccccctctctcaggagaaagacaatgtgtgggactctggactacttgccc
ccggaaatgatagcgcagaaaccgtacaatgagatggttgatctgtggtgcattggggtg
ctctgctatgagctgctggtggggaagccaccctttgagagcagcacctccagtgagaca
tacagacgcatccgccaggtggattttaagtttccttcatcagtacctgcaggagcccag
gacttgatctccaagcttcttaggtaccatccttcagagcggctgagcctggcccaggtc
ctgaagcacccctgggtcagggaacactctcgaagggtgcttccttgctag

DBGET integrated database retrieval system