KEGG   Mus musculus (mouse): 20877Help
Entry
20877             CDS       T01002                                 

Gene name
Aurkb, AIM-1, AIRK2, AL022959, Aik2, Aim1, Ark2, AurB, IPL1, STK-1, Stk12, Stk5
Definition
(RefSeq) aurora kinase B
  KO
K11479  aurora kinase B [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20877 (Aurkb)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20877 (Aurkb)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20877 (Aurkb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20877 (Aurkb)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   20877 (Aurkb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20877 (Aurkb)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     20877 (Aurkb)
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     20877 (Aurkb)
  Sister chromatid separation proteins
   Aurora kinases
    20877 (Aurkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 20877
NCBI-ProteinID: NP_035626
MGI: 107168
Ensembl: ENSMUSG00000020897
Vega: OTTMUSG00000005961
UniProt: O70126
Position
11 B3; 11 42.32 cM
AA seq 345 aa AA seqDB search
MAQKENAYPWPYGSKTSQSGLNTLSQRVLRKEPATTSALALVNRFNSQSTAAPGQKLAEN
KSQGSTASQGSQNKQPFTIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEK
EGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQ
RTATIMEELSDALTYCHKKKVIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCG
TLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSS
VPSGAQDLISKLLKHNPWQRLPLAEVAAHPWVRANSRRVLPPSAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaaggagaacgcctacccgtggccctacggctcaaagacgtctcagtctggc
ctgaacacgttgtcccagagagtcctacggaaggagcccgccacgacatctgcgcttgct
ctcgtgaaccggttcaacagccagtccacagctgcccctggccagaagttggctgagaac
aagagtcagggctccactgcctcgcaaggatcccagaacaagcagcctttcactattgac
aactttgagattgggcgtcctttgggcaaaggcaaatttggaaacgtgtacttggctcgg
gagaagaagagccgtttcatcgtggcactcaagatcctcttcaagtctcagattgagaag
gagggggtagagcaccagcttcgccgagagatcgaaatccaggcgcacctgaaacatccc
aacatccttcaactctacaactacttctacgaccagcagaggatctacttaatcctggaa
tacgcccctcgcggggaactctacaaggaactgcagaagagtcggaccttcgatgagcag
cggactgccacgatcatggaggaactgtcagatgccctgacctactgccacaagaagaag
gtaattcacagagacataaagccggagaacctgctgttaggtctgcagggagaactgaag
attgcagactttggctggtcggtgcatgccccatccctgaggaggaagaccatgtgcggc
acgctggactatctgcccccagagatgattgaggggcgcatgcataatgaaatggtagat
ctatggtgcatcggggtgctctgctatgaactgatggtggggaacccacccttcgagagc
cctagccacagtgagacgtatcgtcggattgtcaaggtggacctgaagttcccctcttct
gtgccttcgggcgcccaggacctcatctccaagctgctcaaacataacccctggcaacgg
ctgcccctggcggaggttgcagctcacccttgggtccgggccaactcaaggagggttctg
cctccctctgccctttag

DBGET integrated database retrieval system