KEGG   Mus musculus (house mouse): 208777
Entry
208777            CDS       T01002                                 
Symbol
Sned1, 6720455I24Rik, D430044C15Rik, SST3, Snep
Name
(RefSeq) sushi, nidogen and EGF-like domains 1
  KO
K24470  insulin-responsive sequence DNA-binding protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    208777 (Sned1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   208777 (Sned1)
SSDB
Motif
Pfam: EGF hEGF fn3 EGF_2 NIDO EGF_CA cEGF
Other DBs
NCBI-GeneID: 208777
NCBI-ProteinID: NP_766051
MGI: 3045960
Ensembl: ENSMUSG00000047793
UniProt: Q70E20 A0A0R4J0N0
Position
1:93163518..93228787
AA seq 1403 aa
MRLGAAWALLLAAALGLGTRGVRAAVALADFYPFGTKRGDTVTPKQDDGGSGLQPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDPAMLNRATEDIRRYFPELPDFSATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGR
FSFTIFNYESILWTTGTHASSGGDTDGLGGIAAQAGFNAGDGHRYFNIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLVLRPCLNGGKCIDDCVTGNPSYTCSCL
AGFTGRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAGFKGPTCESAQSPCDNKVCQN
GGQCQAESSSAVCVCQAGYTGATCETDVDECSSDPCQNGGSCVDLVGNYSCICVEPFEGP
QCETGSYLVPSPCLSNPCQNGGTCVDADEGYVCECPEGFMGLDCRERILNDCDCRNGGRC
LGANTTLCQCPPGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNISHS
LPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHCEKARPHLCSSGPCRNGGTCKEMGD
EYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSP
CFRSPCMNGGTCEDLGTDFSCYCQPGYTGHRCQAEVDCGHPEEVEHATMRFNGTHVGSVA
LYTCEPGFSLSALSHIRVCQPQGVWSQPPQCIEVDECRSQPCLHGGSCQDLIADYQCLCS
PGYEGVHCELETDECQAQPCRNGGSCRDLPRAFICQCPEGFVGIHCETEVDACASSPCQH
GGRCEDGGGAYLCVCPEGFFGYNCETVSDPCFSSPCGSRGYCLASNGSHSCTCKVGYTGK
DCTKELLPPTALRVERVEESGVSISWSPPEGTTARQVLDGYAVTYASSDGSSRRTDFVDR
SRSSHQLRALAAGRAYNISVFSVKRNTNNKNDISRPAALLTRTRPRPIEDFEVTNISANA
ISVQWALHRIQHATVSRVRVSILYPEASAVQSTEVDRSVDRLTFGDLLPGRRYTVRLTTL
SGPGGAEYPTESLASAPLNVWTRPLPPANLTASRVTATSAHMVWDTPAPGISLEAYVINV
TTSQSTKSRYIPNGKLVSYTVRDLMPGRRYQLSVTAVQSTEQGQLHSEPAHLYIITSPRD
GTDRRWHHGGHHSRMLRNRPAPVRLPELRLLNDHSAPETPTQSSRFSELVDGRGRVSARF
GGLPSRAVTVRSQPTTPVPLKNTEAPEQVHLALQLPKNSSKDTESTPGSCSEDACQNGGT
CVPGADAHSCDCRPGFKGRHCELACEKVPRPCTRLFSETKSFPVWEGDICHHVYKKVYKV
HQDVCFKERCQSTSLRKPKQETK
NT seq 4212 nt   +upstreamnt  +downstreamnt
atgcgcctcggcgccgcctgggcgctgctgctggccgcagccctggggctcgggacgcgc
ggggtgcgcgctgccgtggccctcgccgacttctacccgttcggcacgaagcgcggcgac
accgtcaccccgaagcaggacgacggcggctcagggctgcaaccactctcggtgcccttt
ccgttcttcggcgccgagcactccggactctacgtgaacaataatgggatcatctccttc
ctgaaggaagtttctcagttcacccccgtggccttccccatcgccaaagaccgctgtgtg
gtagcagccttctgggcagatgtagacaaccggcgtgcaggtgatgtctactaccgggag
gccaccgacccagccatgctgaacagagccacggaggacatcagacggtactttcctgag
ctcccggacttctctgctacctgggtttttgttgcgacctggtaccgtgtgaccttcttt
ggaggcagcagctcttcccccgttaacacattccaaactgtactcatcaccgatggccga
ttctccttcaccatcttcaactatgagtccatcttgtggactaccggcacacacgccagc
agcgggggtgacactgatggcttgggaggcattgcagcccaggcaggtttcaacgcaggt
gatgggcaccgctacttcaacatccccgggtcgcgcacagcagacatggctgaggtggag
accaccaccaacgtgggcgtgcccggccgctgggcgtttagaatcgatgatgcccaggtg
cgcgtggggggctgcggccatacaacctctgtgtgcctggtcctgcgtccatgcctcaat
ggtggcaagtgcattgatgactgcgtcacgggcaatccctcttacacctgttcctgtctc
gctggcttcacaggccggagatgccacctggatgtgaacgagtgtgcttcccacccctgt
cagaatggtgggacctgcacccatggtgtcaacagcttcagctgccagtgcccagccggc
ttcaagggacccacctgtgaatcggcccaatctccgtgtgacaacaaagtatgtcaaaat
ggtggccagtgccaggcagagagcagctctgcagtatgtgtgtgtcaggctggatacact
ggggccacctgtgagacagatgtggatgaatgcagttctgacccatgccagaatggggga
tcatgtgttgacctggttggaaactacagctgtatttgtgtggagcccttcgagggacct
cagtgtgagacaggaagctacctggtgccttcaccctgcctctccaacccctgccagaac
gggggcacctgtgtggatgctgatgagggatacgtgtgtgaatgccctgaaggcttcatg
ggcttggactgcagagagaggatcctcaatgactgtgactgccggaacggaggcagatgc
ctgggtgccaacaccaccctctgccagtgtcctccaggcttctttgggctcctctgtgaa
tttgaagtcacagccacgccctgcaacatgaacacgcagtgtccagatggaggctactgc
atggagtatggcggaagctacctatgtgtctgccacacagaccacaacatcagccactct
ctgccatccccctgcgactcagacccttgctttaatggaggttcctgtgacgcccacgag
gactcctacacgtgcgagtgccctcgtggattccacggcaggcactgtgagaaagcccgg
ccacacctgtgcagctcagggccctgccggaatggaggcacatgcaaggaaatgggcgac
gagtaccgctgcacctgcccttatagattcactgggagacactgtgagattggaaagcca
gactcctgtgcctctggcccctgtcataatggtgggacttgtttccactacattggcaaa
tacaagtgtgactgccctccaggattctctggacggcactgtgagatagctccctcaccc
tgcttccggagcccatgtatgaatgggggtacctgtgaggatctagggacagatttctcc
tgctactgccagccagggtatacaggacaccggtgtcaggcagaggtggactgtggtcac
cctgaggaggtggagcatgctaccatgcgcttcaacggaactcacgtgggctcagtggcc
ctgtacacatgtgagcccggcttcagcctgagtgccctcagccatatacgtgtctgtcag
ccacaaggggtctggagccagcctccccagtgcattgaagtagatgagtgccggtctcag
ccatgcctgcacggaggctcctgccaggacctcattgctgattaccagtgcctctgcagc
ccggggtatgaaggagtccactgtgagctagagacagatgagtgccaagcacagccatgc
agaaatgggggctcctgcagggacctccccagggctttcatctgccagtgccctgaaggt
tttgttggaatccactgtgaaacagaggtggatgcctgtgcctccagcccctgccagcac
ggaggccggtgtgaggacggtggtggggcctacctgtgcgtgtgtccagagggcttcttt
ggctacaactgtgagacagtgagtgacccctgcttctctagcccctgtgggagccgcggc
tactgcttggccagcaacgggtcccacagctgtacctgcaaagtgggctacacaggcaag
gactgcaccaaagagctcctcccaccaacagccctcagggtagaaagggtggaggagagt
ggggtctccatctcctggagtccacccgagggcaccacggccaggcaggtgctggatggc
tatgcagtcacctatgcctcctcggatggatcgtcccggcgcacagactttgtggaccgg
agccgctcctctcaccagcttcgggccctagcagccggccgcgcctacaatatctccgtt
ttctcagtcaagagaaacacaaacaacaaaaatgacatcagcaggcctgcagcactgctc
acccgcacccgaccccgccctatagaagactttgaggtcaccaacatttcagccaatgcc
atctcagtgcagtgggctcttcacaggatccagcacgccactgtcagcagggtccgggtg
tccatcctctaccccgaggcctctgcggtccagtccactgaggtggacaggagtgtggac
cgcctcacatttggggacctgctgccagggagaagatacactgtgcggctaaccaccctt
agtgggcctggaggagctgaatatcctaccgagagcctggcttcagctccactgaacgtg
tggacccggcctttgccaccagcaaacctgactgcctctcgagtcacagctacctctgcc
catatggtctgggacacccccgctccaggtatctcactggaggcttatgtcatcaatgtg
accacaagtcaaagtaccaagagccgctacatccccaatgggaagctggtgtcctataca
gtgcgtgatctgatgccaggtcggcggtaccagctctcagttacagctgtgcagagcaca
gagcagggccagctgcacagtgagcctgcacacctctacatcatcacctcccccagggat
ggcaccgacagacgctggcaccatggaggacaccactcacggatgctcagaaacagacca
gcccctgtgcgcctgcctgagctgcgcctgctcaatgaccacagtgcccctgaaacacca
actcagtcatccaggttctcagagcttgtagatggaagaggaagagtgagtgccaggttt
ggtggcttgcccagcagagcagtaactgtgagatcacaacccaccactccggtgccactc
aagaacacagaggcccctgagcaggtccatctggccctccagctacccaagaacagcagc
aaagacacagaaagtacccctggcagctgttcagaagatgcttgtcagaatggaggcacc
tgtgtcccaggtgccgatgcccacagctgtgactgcaggcctgggttcaaaggcagacac
tgtgagcttgcctgtgaaaaagtgccccgcccctgcacacggctgttctctgagaccaag
tcatttcctgtctgggaaggcgacatctgccaccatgtgtataagaaagtctacaaagtt
caccaggacgtgtgctttaaggagcgctgccagagcacaagcctcaggaaacccaaacag
gaaacaaagtaa

DBGET integrated database retrieval system