KEGG   Mus musculus (mouse): 20878
Entry
20878             CDS       T01002                                 

Gene name
Aurka, AI, AIRK1, ARK-1, AU019385, AW539821, Ar, Ark1, Au, Aurora-A, Ayk, Ayk1, I, IA, IAK, IAK1, Stk, Stk6
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    20878 (Aurka)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    20878 (Aurka)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20878 (Aurka)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20878 (Aurka)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20878 (Aurka)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20878 (Aurka)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   20878 (Aurka)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20878 (Aurka)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    20878 (Aurka)
   Spindle formation proteins
    20878 (Aurka)
  Sister chromatid separation proteins
   Aurora kinases
    20878 (Aurka)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal APH Seadorna_VP7
Other DBs
NCBI-GeneID: 20878
NCBI-ProteinID: NP_001278114
MGI: 894678
Ensembl: ENSMUSG00000027496
Vega: OTTMUSG00000016161
UniProt: P97477 Q3TEY6
Structure
PDB: 

Position
2 H3; 2 94.84 cM
AA seq 395 aa
MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQ
KLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWT
LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLR
HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS
KRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEK
VDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNAS
QRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctccaggcctgttaagaccactgttcccttcggt
ccgaaacgcgtcttggtgactgagcagattccgtctcagaacctaggatctgctagcagt
ggccaggcccagcgggtcctgtgtccttctaactcccagcgtgtcccttcacaagcccag
aaacttggagcaggtcagaagccggcaccaaagcagttgccagctgccagtgttcctagg
cctgtgtcccggctcaataacccccagaagaatgagcagcctgcagcctccggaaatgat
tctgaaaaggagcaggcatccttgcagaagaccgaagacacaaaaaaaaggcagtggact
ttggaagattttgacattggccgcccactaggaaaagggaagtttggaaatgtctacttg
gcgcgggagagacaaagcaagttcatcctggctctgaaggtgctgtttaaaacacagctg
gagaaggcgaacgtggagcaccagcttcggagagaggtggagatccagtcgcacctgcgg
caccccaacatcctcaggctgtatggctatttccatgacgccacccgagtttatctgatt
ctagaatatgcgccccttggaacagtctatagagagctccaaaaactctccaagtttgac
gagcagagaacagctacttacatcactgagttggcaaacgctctgtcttactgtcattca
aagagagtgatccacagagacattaagccagagaacttactgcttggctcaaacggagag
ttgaagattgcagacttcgggtggtcggtgcatgctccatcttccaggagaaccacaatg
tgtggcaccctggactacctgcccccagagatgattgaaggccggatgcatgacgagaag
gtggacctctggagcctcggcgttctctgctatgagttcctagtggggatgcctcctttc
gaggcacacacgtaccaggagacttacagaaggatatctcgggttgaattcactttccct
gactttgtgacagagggagccagggacctcatttcaagactgttaaaacacaacgcaagc
caaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattcttccaaa
cctccaactggccacactagcaaagagccaaccagcaaatcatcttag

DBGET integrated database retrieval system