KEGG   Mus musculus (mouse): 20878Help
Entry
20878             CDS       T01002                                 

Gene name
Aurka, AIRK1, ARK-1, AU019385, AW539821, Ark1, Aurora-A, Ayk1, IAK, IAK1, Stk6
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    20878 (Aurka)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    20878 (Aurka)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20878 (Aurka)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20878 (Aurka)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20878 (Aurka)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20878 (Aurka)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   20878 (Aurka)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20878 (Aurka)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    20878 (Aurka)
   Spindle formation proteins
    20878 (Aurka)
  Sister chromatid separation proteins
   Aurora kinases
    20878 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 APH Seadorna_VP7 Pkinase_fungal YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 20878
NCBI-ProteinID: NP_001278114
MGI: 894678
Ensembl: ENSMUSG00000027496
Vega: OTTMUSG00000016161
UniProt: P97477 Q3TEY6
Structure
PDB: 

Position
2 H3; 2 94.84 cM
AA seq 395 aa AA seqDB search
MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQ
KLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWT
LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLR
HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS
KRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEK
VDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNAS
QRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctccaggcctgttaagaccactgttcccttcggt
ccgaaacgcgtcttggtgactgagcagattccgtctcagaacctaggatctgctagcagt
ggccaggcccagcgggtcctgtgtccttctaactcccagcgtgtcccttcacaagcccag
aaacttggagcaggtcagaagccggcaccaaagcagttgccagctgccagtgttcctagg
cctgtgtcccggctcaataacccccagaagaatgagcagcctgcagcctccggaaatgat
tctgaaaaggagcaggcatccttgcagaagaccgaagacacaaaaaaaaggcagtggact
ttggaagattttgacattggccgcccactaggaaaagggaagtttggaaatgtctacttg
gcgcgggagagacaaagcaagttcatcctggctctgaaggtgctgtttaaaacacagctg
gagaaggcgaacgtggagcaccagcttcggagagaggtggagatccagtcgcacctgcgg
caccccaacatcctcaggctgtatggctatttccatgacgccacccgagtttatctgatt
ctagaatatgcgccccttggaacagtctatagagagctccaaaaactctccaagtttgac
gagcagagaacagctacttacatcactgagttggcaaacgctctgtcttactgtcattca
aagagagtgatccacagagacattaagccagagaacttactgcttggctcaaacggagag
ttgaagattgcagacttcgggtggtcggtgcatgctccatcttccaggagaaccacaatg
tgtggcaccctggactacctgcccccagagatgattgaaggccggatgcatgacgagaag
gtggacctctggagcctcggcgttctctgctatgagttcctagtggggatgcctcctttc
gaggcacacacgtaccaggagacttacagaaggatatctcgggttgaattcactttccct
gactttgtgacagagggagccagggacctcatttcaagactgttaaaacacaacgcaagc
caaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattcttccaaa
cctccaactggccacactagcaaagagccaaccagcaaatcatcttag

DBGET integrated database retrieval system