KEGG   Mus musculus (mouse): 208836
Entry
208836            CDS       T01002                                 

Symbol
Fanci
Name
(RefSeq) Fanconi anemia, complementation group I
  KO
K10895  fanconi anemia group I protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    208836 (Fanci)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    208836 (Fanci)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     208836 (Fanci)
SSDB
Motif
Pfam: FANCI_S4 FANCI_HD2 FANCI_S3 FANCI_S1 FANCI_S2 FANCI_HD1 FANCI_S1-cap
Other DBs
NCBI-GeneID: 208836
NCBI-ProteinID: NP_666058
MGI: 2384790
Ensembl: ENSMUSG00000039187
Vega: OTTMUSG00000029069
UniProt: Q8K368
Structure
PDB: 
3S51 3S4W 3S4Z

Position
7; 7 D2
AA seq 1330 aa
MDLKILSLATDKTTDKLQEFLQTLKDDDLASLLQNQAVKGRAVGTLLRAVLKGSPCSEED
GALRRYKIYSCCIQLVESGDLQQDVASEIIGLLMLEVHHFPGPLLVDLASDFVGAVREDR
LVNGKSLELLPIILTALATKKEVLACGKGDLNGEEYKRQLIDTLCSVRWPQRYMIQLTSV
FKDVCLTPEEMNLVVAKVLTMFSKLNLQEIPPLVYQLLVLSSKGSRRSVLDGIIAFFREL
DKQHREEQSSDELSELITAPADELYHVEGTVILHIVFAIKLDCELGRELLKHLKAGQQGD
PSKCLCPFSIALLLSLTRIQRFEEQVFDLLKTSVVKSFKDLQLLQGSKFLQTLVPQRTCV
STMILEVVRNSVHSWDHVTQGLIEFGFILMDSYGPKKILDGKAVEIGTSLSKMTNQHACK
LGANILLETFKIHEMIRQEILEQVLNRVVTRTSSPINHFLDLFSDIIMYAPLILQNCSKV
TETFDYLTFLPLQTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFL
LLLKNFKVLGSLPSSQCTQSIGVTQVRVDVHSRYSAVANETFCLEIIDSLKRSLGQQADI
RLMLYDGFYDVLRRNSQLASSIMQTLFSQLKQFYEPEPDLLPPLKLGACVLTQGSQIFLQ
EPLDHLLSCIQHCLAWYKSRVVPLQQGDEGEEEEEELYSELDDMLESITVRMIKSELEDF
ELDKSADFSQNTNVGIKNNICACLIMGVCEVLMEYNFSISNFSKSKFEEILSLFTCYKKF
SDILSEKAGKGKAKMTSKVSDSLLSLKFVSDLLTALFRDSIQSHEESLSVLRSSGEFMHY
AVNVTLQKIQQLIRTGHVSGPDGQNPDKIFQNLCDITRVLLWRYTSIPTSVEESGKKEKG
KSISLLCLEGLQKTFSVVLQFYQPKVQQFLQALDVMGTEEEEAGVTVTQRASFQIRQFQR
SLLNLLSSEEDDFNSKEALLLIAVLSTLSRLLEPTSPQFVQMLSWTSKICKEYSQEDASF
CKSLMNLFFSLHVLYKSPVTLLRDLSQDIHGQLGDIDQDVEIEKTDHFAVVNLRTAAPTV
CLLVLSQAEKVLEEVDWLIAKIKGSANQETLSDKVTPEDASSQAVPPTLLIEKAIVMQLG
TLVTFFHELVQTALPSGSCVDTLLKGLSKIYSTLTAFVKYYLQVCQSSRGIPNTVEKLVK
LSGSHLTPVCYSFISYVQNKSSDAPKCSEKEKAAVSTTMAKVLRETKPIPNLVFAIEQYE
KFLIQLSKKSKVNLMQHMKLSTSRDFKIKGSVLDMVLREDEEDENEEGTASAHTQQDREP
AKKRRKKCLS
NT seq 3993 nt   +upstreamnt  +downstreamnt
atggatctgaaaattttatctctagcaacagataaaactacagataaactgcaggagttt
cttcaaaccctgaaagatgatgatttggccagtctccttcagaaccaagcggtgaaagga
agagctgttggaacgctcctgagagccgtcctcaaaggctccccctgctctgaggaagat
ggagcccttaggagatacaagatatattcttgctgtatccagttggttgaatcgggagat
ttgcagcaagatgtcgcatcagagatcataggattactaatgctggaggtccaccatttt
ccaggcccattacttgttgacttggctagtgactttgtgggtgctgtccgagaggaccgc
ctagtgaatggaaaatctttggagttattacccatcatccttactgccttggccaccaag
aaggaagtcctcgcttgtgggaaaggtgatttgaatggggaagaatataagaggcagttg
attgacaccctgtgttctgtcagatggcctcaacggtacatgatccagctcacttctgtg
ttcaaggatgtctgtctaacgccagaagagatgaatctcgtggtggccaaagtgttgacg
atgttctcaaagttgaatcttcaagaaattccacctttggtctatcagcttctggttctc
tcttccaagggaagcagaaggagtgttctggacggaatcatagccttcttcagggagctg
gataagcagcacagggaggaacagagcagcgatgagttgtcagagcttattactgcccca
gcagacgaactctatcacgtggaaggcaccgttattctgcacatcgtatttgccatcaaa
ctggactgtgaattaggcagagaacttctgaaacacttgaaggctggacagcagggggat
cccagtaaatgcctatgtcccttcagcatcgctcttctcctctctctcacgagaatacag
agatttgaggaacaggtgtttgatcttttaaagacttctgttgtaaaaagcttcaaggat
cttcagctcctccaaggctccaagtttcttcagactctcgtcccccagagaacttgtgtt
tcaaccatgatcttagaagtggtgaggaacagtgttcatagttgggatcatgtaactcaa
ggtctgatagaatttggtttcatcttgatggattcctatgggccaaagaagattcttgat
ggaaaagctgttgaaattggcaccagtctttctaaaatgacaaaccagcacgcatgtaag
ctgggagctaatatcttattggaaacctttaaaatccacgagatgatcagacaagaaatt
ctggagcaagtcctcaacagagttgttacgcgaacatcctctcccatcaatcatttctta
gacttgttttcagatatcatcatgtatgcacctttaattcttcagaactgttcaaaagtc
acggaaacttttgactatttgacctttctgcccctccagaccgtgcaagggctgctcaag
gcggtgcagccgcttctcaagatcagcatgtcgatgagagactccttgatcctcgtcttg
cggaaagctatgtttgccagccagctggatgcccggaaatctgcagttgctgggtttttg
ctgctcctaaagaactttaaagtcctaggcagcctgccgtcctcacagtgcacacagtct
attggtgtcacgcaggtgcgcgtggacgttcacagccgatacagcgctgtcgccaacgag
accttctgccttgagatcatagacagcttgaaacgaagcttagggcagcaggcagacatc
cggctcatgctttacgacggtttctacgatgtccttcgacggaactctcagctggctagt
tcaatcatgcagactctcttctcacagttaaaacagttctatgagccagagcctgatctg
ctacctcctctgaaactaggagcttgtgttctgacccaaggaagtcagatctttctacaa
gagccgctggatcatctgctgtcttgcattcagcattgcttggcctggtataagagcaga
gtcgtccccctgcaacaaggagatgaaggagaggaggaggaggaggagttgtactccgag
ctggatgatatgttggagtccattactgtcagaatgatcaagagtgagctggaagacttt
gagctggataaatcagcagatttctctcagaacactaatgtcggcatcaagaataatatc
tgtgcgtgtctcatcatgggagtgtgtgaagttctaatggaatataatttctccataagt
aacttcagcaagagtaagtttgaggagatcctgagcctcttcacatgttacaagaagttc
tctgacatcctcagtgagaaagctggcaaaggcaaggctaagatgaccagtaaagtcagc
gacagtctcctgtccttgaagtttgtgtctgatctcctcactgctctcttcagagacagc
atccagagtcatgaagagagtctgtctgtcctgcggtccagcggcgagtttatgcactat
gcagtgaacgtcactttgcagaagattcagcagctaatacgaacagggcatgtgagtggc
cctgatggtcagaacccagacaagatctttcagaacctctgtgacataactcgggtcctg
ctgtggagatacacatcaattcctacatccgtggaggagtcggggaagaaggagaaggga
aagagcatctcgctgttgtgcttggagggcttgcagaagacgttcagtgtggtgctgcag
ttctaccagcccaaggtccagcagtttctccaggctctggatgtcatgggcacagaagaa
gaagaagcaggtgtcactgtcactcagagggcctcgttccagatccggcagtttcagagg
tcgttgttgaatctgctgagcagcgaagaggacgattttaacagtaaagaggccctcctg
ctcatcgcggtgctgtccaccttgtccaggctgctggagcccacctctcctcagtttgtg
cagatgttatcctggacatctaagatttgcaaggaatacagccaggaggatgcctcattt
tgcaagagtttgatgaacctgttcttcagcctgcatgtcttatataagagtcctgtcacc
ctgcttcgtgacttgtcccaggatatccatgggcagctgggagacatagatcaagatgta
gagattgagaagacagaccactttgctgtggtgaatttgagaacggctgcccccactgtc
tgtttacttgttctgagtcaggctgagaaagtcctagaagaagtggactggttaatcgcc
aagatcaagggctcagcaaaccaagaaacgctatcagataaagtgactccagaagatgcc
tcttctcaagccgttccaccaactcttctcattgagaaagctatcgtcatgcaactggga
actctggtaacgttcttccatgagctcgtgcagacagccctgccatcaggcagctgtgta
gacactctactgaagggcctgtccaagatctacagcaccctaacagcattcgtcaaatat
tatctccaggtatgtcagagctccagaggaattccaaacactgtggaaaaactggtgaag
ctgtcgggctctcatctgacccccgtatgttactctttcatttcttatgtacaaaataag
agcagtgacgccccaaagtgctcagaaaaggagaaggctgcagtgagcacaaccatggcc
aaagttcttcgtgaaaccaagccaatccctaaccttgtctttgccattgaacagtatgaa
aaatttcttatccaactgtctaaaaagtccaaggtaaacctgatgcagcacatgaagctg
agtacttctcgggacttcaagatcaaaggcagtgtcctcgacatggttcttcgagaggat
gaggaagacgaaaacgaagagggcactgcatcagcacatacacagcaggacagagaacca
gccaagaagaggaggaagaaatgcctgagttaa

DBGET integrated database retrieval system