KEGG   Mus musculus (house mouse): 208922
Entry
208922            CDS       T01002                                 
Symbol
Cpeb3, 4831444O18Rik, CPE-BP3, mKIAA0940
Name
(RefSeq) cytoplasmic polyadenylation element binding protein 3
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    208922 (Cpeb3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    208922 (Cpeb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    208922 (Cpeb3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     208922 (Cpeb3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     208922 (Cpeb3)
   mRNA cycle factors
    P-body specific factors
     208922 (Cpeb3)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 zf-B_box
Other DBs
NCBI-GeneID: 208922
NCBI-ProteinID: NP_001277755
MGI: 2443075
Ensembl: ENSMUSG00000039652
UniProt: Q7TN99 A0A0R4J102
Position
19:complement(36996742..37185018)
AA seq 716 aa
MQDDLLMDKSKTQPQSQQQQRQQQQQQQQLQPEPGAAEAPSTPLSSEIPKPEDSSAVPAL
SPASAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPTAPGASLSPSFGSTWSTGTT
NAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPQPPQP
AQPPQAQPSQQRRSPASPSQAPYAQRSAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSAS
SSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSN
VIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRT
DHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNTRSYGRRRGRSS
LFPFEDAFLDDSHGDQALSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFR
RFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKD
KPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGID
TDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGT
RCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcaggatgatttactgatggacaaaagcaaaacccagccccagtctcagcagcagcag
cggcagcagcagcagcagcagcaacagctccagcccgagcccggcgcagctgaagccccg
tccacgcccctctcctcagagatccccaagcccgaagacagtagcgcagtgccggccctc
agccccgcctcggctccgccagcccccaacggccccgacaagatgcagatggagtcgccg
ctcctgccgggcttgagtttccatcagccccctcagcagccgccgccgccgcaggagccc
acggcgcccggagcgtcgctgtcgccgtccttcggcagcacctggtccacaggcactaca
aacgcggtggaggacagcttcttccaggggatcaccccagtcaacgggaccatgctcttc
caaaacttcccgcaccacgtcaacccggtcttcggaggcaccttctcgccgcagatcggc
ctggcgcagacccagcaccatcagcagcctccaccgcccgcgccgcagccgccgcagccc
gcgcagcccccgcaggcgcagccctcgcagcaacgccgctcgcccgccagccccagccag
gcgccctatgcgcagaggagcgccgctgcctacggccaccagcccatcatgaccagcaag
ccgtcctcatcctcggcggtcgcggctgctgcggccgcggccgctgcctcttcggcctcg
tccagctggaacacgcaccagagcgtgaacgccgcctggagtgctccgtccaacccgtgg
ggtggcctgcaggcgggccgagaccctcgccgcgcggtcggcgtgggcgtgggtgtaggt
gtgggggtaccctccccgcttaaccccatctcgccgctcaaaaagcccttctccagcaat
gtgatcgctccacccaagttccctcgtgcagccccgctcacctccaagtcctggatggag
gataacgctttccggaccgataatggtaacaatctgttgccttttcaggaccggagtagg
ccctatgacacttttaacttgcactccttggagaactccttaatggatatgataaggact
gaccatgagcctctgaaaggtaaacactaccctcccagtggcccaccaatgagtttcgct
gatataatgtggaggaatcattttgcaggacgcatgggaataaatttccaccatccagga
acagataacattatggcacttaacaccaggagctatgggcggagacgaggtcggtcttct
ctctttccctttgaagacgccttcttggatgacagccatggtgatcaggccttatcgtct
ggcttaagttctcctactcgatgtcaaaatggggaacgagtggaacgctactctagaaag
gtgtttgttggaggccttcctcctgacatcgatgaagatgagatcactgccagctttcgc
aggtttggaccccttgtggtggactggcctcataaagccgagagcaaatcgtacttccct
cctaaaggctatgctttcctgctgttccaggaggagagctcagtgcaagctctgatagat
gcctgcctggaggaggatgggaaactgtacctgtgtgtgtccagcccaaccatcaaggat
aaaccggtgcaaatccgaccgtggaacctaagtgacagtgactttgtaatggatggctct
cagcctttggaccccagaaaaactatctttgttgggggagttccacgaccccttcgagct
gttgaactggcaatgataatggaccgtttgtacggtggtgtttgctatgctggcattgac
acagacccagagctgaagtacccgaaaggtgctgggcgtgttgcgttctccaatcagcag
agctacattgcagccatcagtgcgcgctttgtgcaacttcaacacaacgacattgacaaa
cgggtggaagtgaagccgtacgtgctggatgatcagatgtgtgacgagtgtcagggcaca
cgctgcggggggaagtttgccccattcttctgtgccaacgtcacctgtctgcagtactac
tgtgaatactgctgggccagcatccactcccgagccggccgtgagttccacaaaccgctg
gtgaaggagggaggcgaccgcccccggcacgtcccgttccgctggagctga

DBGET integrated database retrieval system