KEGG   Mus musculus (house mouse): 20893
Entry
20893             CDS       T01002                                 
Symbol
Bhlhe40, Bhlhb2, C130042M06Rik, CR8, Clast5, Dec1, Sharp2, Stra13, Stra14
Name
(RefSeq) basic helix-loop-helix family, member e40
  KO
K03729  class B basic helix-loop-helix protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    20893 (Bhlhe40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20893 (Bhlhe40)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    20893 (Bhlhe40)
SSDB
Motif
Pfam: HLH Hairy_orange Oscp1
Other DBs
NCBI-GeneID: 20893
NCBI-ProteinID: NP_035628
MGI: 1097714
Ensembl: ENSMUSG00000030103
UniProt: O35185 Q542A5
Position
6:108637590..108643886
AA seq 411 aa
MERIPSAQPPPTCLPKAPGLEHGDLSGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGASRKPLDSAPKAVDLKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSDTD
TDSGYGGELEKGDLRSEQPYFKSDHGRRFAVGERVSTIKQESEEPPTKKSRMQLSEEEGH
FAGSDLMGSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNTSAA
ALSSFMNPDKIPTPLLLPQRLPSPLAHSSLDSSALLQALKQIPPLNLETKD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggaacggatccccagcgcgcaaccacctcctacctgcctgcccaaagctccagggctg
gagcacggagacctgtcagggatggattttgcccacatgtaccaagtgtacaagtccagg
cggggaataaaacggagcgaagacagcaaggaaacttacaaactgccgcaccggctgatt
gagaaaaagagacgtgaccggattaacgagtgcattgcccagctgaaggatctcctaccc
gaacatctcaaacttactactttgggtcacttggaaaaagcagtggttctggagcttacg
ttgaagcacgtgaaagcattgacaaatctaattgatcagcagcagcagaaaatcattgcc
ctgcagagcggtttacaagctggtgatttgtcgggaagaaatctcgaggcagggcaagaa
atgttctgctcaggtttccagacttgtgcccgtgaggtacttcagtacctggcgaagcat
gagaacactcgggacctgaaatcttcccagctcgtcactcatctccatcgtgtggtctcg
gagctgctgcagggtggtgcttccaggaaaccattggactcggctcccaaagccgtggac
ttgaaagagaagcccagcttcctagccaagggatcagaaggccctgggaaaaactgtgtg
ccagtcatccagcggacttttgctccctcgggtggggagcagagcggcagtgacacggac
acagacagtggctatggaggtgaattggagaagggggacttgcgcagtgagcagccgtac
ttcaaaagcgaccatggacgcaggttcgccgtgggagaacgtgtcagcacaattaagcaa
gaatccgaagagccccccaccaaaaagagccgaatgcagctctcagaagaggaaggccac
ttcgcgggcagtgatctgatgggttccccatttcttgggccacacccacatcagcctcct
ttttgccttcccttctatctcatcccaccatcggccactgcctacctgcctatgctggag
aaatgctggtaccccacctctgtgccagtgttatacccaggcctcaacacctcagctgca
gccctctccagcttcatgaacccagacaagataccgactcccttgcttctgccccagaga
ctcccttctcctttggcacattcgtccctcgactcttcggccttgctccaggctttgaag
cagatccctcctttaaacttagaaaccaaagactaa

DBGET integrated database retrieval system