KEGG   Mus musculus (house mouse): 209027
Entry
209027            CDS       T01002                                 
Symbol
Pycr1, P5CR_1, P5CR1
Name
(RefSeq) pyrroline-5-carboxylate reductase 1
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00015  Proline biosynthesis, glutamate => proline
mmu_M00972  Proline metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    209027 (Pycr1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     209027 (Pycr1)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Other DBs
NCBI-GeneID: 209027
NCBI-ProteinID: NP_001335151
MGI: 2384795
Ensembl: ENSMUSG00000025140
UniProt: Q922W5 Q3UTR5
Position
11:complement(120527591..120534602)
AA seq 309 aa
MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDQATVSALRKIGVNLTPHNKETV
RHSDVLFLAVKPHIIPFILDEIGANIEDRHIVVSCAAGVTINSIEKKLTAFQPAPKVIRC
MTNTPVVVREGVTVYATGTHAQVEDGRLVEQLMGSVGFCTEVEEDLIDAVTGLSGSGPAY
AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPSQLKDNVCSPGGATIH
ALHVLESGGFRSLLINAVEASCIRTRELQTMADQETISPAAIKKTVLDKVKLDSSAGASL
SSDHVKPLP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagcgtaggcttcatcggggcagggcagctagcctttgctctagccaagggcttcaca
gctgcaggtgttctggctgcacacaagataatggccagctccccagacatggaccaagct
acggtctcggccctccggaagataggggtgaacctgacaccccacaacaaagagactgtg
cgccacagtgatgtgctcttcctggctgtgaagccacacatcatccccttcatcctggat
gaaattggggcgaacattgaggacaggcacattgtggtgtcttgtgcggcaggggtcacc
atcaactccatcgaaaagaagctgacagcgttccaacctgcccccaaagtcatccgatgt
atgactaacaccccggtcgtggtacgggagggggtcactgtgtatgccacaggtactcac
gctcaggtggaagatggcaggcttgtggagcagctcatgggcagcgtgggcttctgcaca
gaggtggaggaagatctgatcgatgctgtcacagggctcagtggcagcggccctgcctat
gctttcacagccctggatgctctggctgacggtggtgtgaaaatggggcttcccagacgc
ctggcagtccgcctcggggcccaggccctcctgggggcagccaagatgctactagactca
gaacagcatcccagccagctcaaggataatgtctgctctccgggtggggccaccatccat
gccttgcatgtgctggagagcgggggctttcgctccttgcttatcaacgctgtggaagcc
tcctgcatccgtacacgggagctgcagaccatggctgaccaggagaccatctctcctgct
gccataaagaagactgtactggataaggtgaagctggactcctctgctggggcctctctg
tcttctgaccatgtcaagccactgccctga

DBGET integrated database retrieval system