KEGG   Mus musculus (mouse): 20907
Entry
20907             CDS       T01002                                 

Gene name
Stx1a, HPC-, HPC-1
Definition
(RefSeq) syntaxin 1A (brain)
  KO
K04560  syntaxin 1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
mmu04911  Insulin secretion
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    20907 (Stx1a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    20907 (Stx1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20907 (Stx1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20907 (Stx1a)
   05022 Pathways of neurodegeneration - multiple diseases
    20907 (Stx1a)
  09165 Substance dependence
   05031 Amphetamine addiction
    20907 (Stx1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20907 (Stx1a)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    20907 (Stx1a)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Ferritin GNVR Prominin PspA_IM30 Syntaxin-6_N Laminin_II FAD_binding_1 CorA FlgN LMBR1 Lzipper-MIP1 SIMPL DUF148 Lipoprotein_2 DUF1910
Other DBs
NCBI-GeneID: 20907
NCBI-ProteinID: NP_058081
MGI: 109355
Ensembl: ENSMUSG00000007207
Vega: OTTMUSG00000016270
UniProt: O35526 Q5D0A4 Q497P1
Position
5; 5 G2
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgacgacgacgatgtc
actgtcactgtggaccgagaccgcttcatggatgaattctttgaacaggtggaagagatc
cggggctttattgacaagattgccgaaaacgtggaggaggtgaagcggaaacacagcgcc
atcctggcctccccgaaccccgatgagaagacaaaggaggaactggaggagctcatgtcg
gacattaagaagacagcgaacaaagttcgctccaagctaaagagcattgagcagagcatc
gagcaggaggaaggtctgaaccgctcatcagccgacctgaggatccggaagacgcagcac
tccacgctgtcccgaaagtttgtggaggtcatgtccgagtacaacgccactcagtcagac
taccgagaacgctgcaaagggcgcatccagaggcagctggagatcaccggccggaccacg
accagtgaggaattggaagacatgctggagagtgggaaccctgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggccctcagtgagatcgagaccagacacagt
gagatcatcaagctggagaccagcatccgggagctgcacgacatgttcatggacatggcc
atgctggtggagagccagggggagatgattgacaggatcgagtacaatgtggagcacgcc
gtggactacgtggagagggccgtgtcagacaccaagaaggccgtcaagtaccagagcaag
gcgcgcaggaagaagatcatgatcatcatttgctgtgtgattctgggcatcatcatcgcc
tccaccatcgggggcatctttggatag

DBGET integrated database retrieval system