KEGG   Mus musculus (mouse): 20908
Entry
20908             CDS       T01002                                 

Gene name
Stx3, Syn-3
Definition
(RefSeq) syntaxin 3
  KO
K08486  syntaxin 1B/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    20908 (Stx3)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20908 (Stx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20908 (Stx3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20908 (Stx3)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    20908 (Stx3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   20908 (Stx3)
  Exosomal proteins of other body fluids (saliva and urine)
   20908 (Stx3)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch GyrB_insert SIMPL DUF3040 T2SSF RP-C_C Podoplanin
Other DBs
NCBI-GeneID: 20908
NCBI-ProteinID: NP_689344
MGI: 103077
Ensembl: ENSMUSG00000041488
Vega: OTTMUSG00000061360
UniProt: Q64704 Q3UZI9
Position
19; 19 A
AA seq 289 aa
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKRAMKYQGQARKKLIIIIVVVVVLLGILALIIGLSVGLK
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaggaccggctggagcagctgaaggccaagcagctgacgcaggatgatgacacggac
gaggttgagattgccattgacaacacagccttcatggacgagttcttctctgagatcgag
gaaacacggctcaacattgacaagatctcggagcatgtagaggaagctaagaaactctac
agtatcattctctctgcaccgatcccagagccaaaaaccaaagatgaccttgaacagctc
acaactgagatcaagaaaagggccaacaacgtccggaacaagctgaagagcatggagaag
cacattgaggaagatgaggttcggtcatctgcagaccttcggatacgaaagtcccagcac
tccgtcctctcccggaagtttgtggaggtgatgacaaagtacaatgaggctcaggtggac
ttccgtgaacgcagcaaagggcgcatccaacggcagcttgaaattactggcaagaagaca
acagatgaggagctggaagagatgttggagagtggcaacccagccatcttcacttctggg
atcattgactcccagatttccaagcaagccctcagcgagattgagggtcggcacaaggac
atcgtaaggctggagagcagcatcaaggagctccatgacatgtttatggacatcgccatg
ctggtggaaaatcagggggagatgttagataacatagagttgaatgtcatgcacacagtg
gaccatgtggagaaggcacgggatgaaactaaaagagccatgaagtatcagggtcaggct
cggaagaaattgataattatcattgtggtagtagttgtgttgctgggcattttagcgttg
attattggactgtccgttgggctgaaataa

DBGET integrated database retrieval system