KEGG   Mus musculus (mouse): 20910
Entry
20910             CDS       T01002                                 

Symbol
Stxbp1, AI317162, AI326233, MMS10-G, Ms10g, Munc-18a, Munc18-1, N-sec1, Rb-sec1, Sxtbp1, Unc18-1, Unc18h, nsec1
Name
(RefSeq) syntaxin binding protein 1
  KO
K15292  syntaxin-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20910 (Stxbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20910 (Stxbp1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20910 (Stxbp1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    20910 (Stxbp1)
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    20910 (Stxbp1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20910 (Stxbp1)
SSDB
Motif
Pfam: Sec1 YlbD_coat FRB_dom
Other DBs
NCBI-GeneID: 20910
NCBI-ProteinID: NP_033321
MGI: 107363
Ensembl: ENSMUSG00000026797
Vega: OTTMUSG00000012527
UniProt: O08599
Position
2 B; 2 22.09 cM
AA seq 594 aa
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVED
INKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVK
SRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLC
ATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPS
SPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVS
QEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQG
TVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTP
IIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIF
ILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcccccattggcctcaaggcggtggtcggagagaagatcatgcatgatgtgatcaag
aaggtgaagaagaagggcgagtggaaggtgctggtggtggaccagttaagcatgaggatg
ctgtcctcctgctgcaagatgacagacatcatgaccgagggcatcacaattgtggaggat
atcaacaagcgccgagagccactccccagcctggaggccgtgtacctcatcaccccatct
gagaagtctgtccactctctgatcagtgattttaaggacccgccgactgctaaatatcgg
gctgcgcatgtgttcttcacagactcgtgtccagatgccctatttaacgagctggtaaaa
tcccgagcagccaaagtcatcaagacgctgacggaaatcaacattgcgtttctcccctat
gagtcccaggtgtattccctggactccgctgactctttccaaagcttctacagccctcac
aaggcgcagatgaagaatccgatactggaacgcctggcagagcagatcgcaaccctgtgt
gccaccctgaaggagtatccagctgtgcggtatcggggggagtacaaggacaatgccttg
ctggctcagctgatccaggacaagctggatgcctataaagccgacgatccaacaatgggg
gagggtcccgacaaggcacggtcccagctcctgatcctggatcgtggctttgaccccagc
tcccctgtgctccatgaactgacattccaggctatgagttatgacctgctgcctatcgaa
aatgatgtttacaagtatgagaccagcggcattggagaggcgcgggtgaaggaggtgcta
ctggatgaggacgatgacctgtggattgcgctgcgacacaagcacatcgcagaggtgtcc
caggaagtcacccggtctctgaaggacttttcctctagcaagaggatgaacactggcgag
aagaccaccatgcgggacctgtcccagatgctgaagaaaatgccccagtaccagaaggag
ctcagcaagtattcgactcacctgcaccttgctgaagactgcatgaagcattaccaaggc
actgtagacaaactctgccgcgtggagcaggacctggcaatgggcacagatgctgagggg
gaaaaaatcaaggaccccatgagagccattgtccccatcctgctggatgcgaacgtcagc
acttacgacaaaatccgtatcatccttctctacatcttcctgaagaacggtatcactgag
gagaacctaaacaaactcatccagcacgctcagatacccccagaggacagcgagatcatc
accaacatggctcacctcggcgtgcccatcgtcacggattccacactacgccgccgaagc
aaaccggagcggaaggagcgtatcagtgagcagacctaccagctctcacgatggaccccg
atcattaaagacattatggaggacactatcgaagacaagctggatacaaagcactaccca
tacatctctacccgctcgtccgcgtccttcagcaccactgctgtgagtgcccgctatgga
cattggcacaagaataaggcccccggggagtaccgcagcggtccccgcctcattattttc
atccttgggggtgtgagcctgaatgagatgcgctgtgcttacgaagtgacccaggccaac
ggcaagtgggaagtgctgataggatccacgcacattctcaccccacagaaactgctggac
acgctgaagaagctgaataaaacagatgaagaaataagcagttaa

DBGET integrated database retrieval system