KEGG   Mus musculus (house mouse): 20911
Entry
20911             CDS       T01002                                 
Symbol
Stxbp2, C79054, Munc-18-2, Munc-18b, Munc18b, Sxtbp2, Sxtp2, Unc18-2, Unc18b, muSec1
Name
(RefSeq) syntaxin binding protein 2
  KO
K15300  syntaxin-binding protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20911 (Stxbp2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20911 (Stxbp2)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    20911 (Stxbp2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   20911 (Stxbp2)
  Exosomal proteins of other body fluids (saliva and urine)
   20911 (Stxbp2)
  Exosomal proteins of melanoma cells
   20911 (Stxbp2)
SSDB
Motif
Pfam: Sec1 YlbD_coat HBM DASH_Hsk3
Other DBs
NCBI-GeneID: 20911
NCBI-ProteinID: NP_035633
MGI: 107370
Ensembl: ENSMUSG00000004626
UniProt: Q64324 Q548T0
Position
8:3680960..3693998
AA seq 593 aa
MAPLGLKAVVGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVED
INKRREPIPSLEAIYLLSPTEKSVQALIADFQGTPTFTYKAAHIFFTDTCPEPLFSELGR
SRLAKAVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAGERGRQLDALAQQIATLC
ATLQEYPSIRYRKGPEDTAQLAHAVLAKLNAFKADTPSLGEGPEKTRSQLLIMDRAADPV
SPLLHELTFQAMAYDLLDIEQDTYRYETTGLSESREKAVLLDEDDDLWVELRHMHIADVS
KKVTELLKTFCESKRLTTDKANIKDLSHILKKMPQYQKELNKYSTHLHLADDCMKHFKGS
VEKLCSVEQDLAMGSDAEGEKIKDAMKLIVPVLLDASVPPYDKIRVLLLYILLRNGVSEE
NLAKLIQHANVQSYSSLIRNLEQLGGTVTNSAGSGTSSRLERRERMEPTYQLSRWSPVIK
DVMEDVVEDRLDRKLWPFVSDPAPVPSSQAAVSARFGHWHKNKAGVEARAGPRLIVYIVG
GVAMSEMRAAYEVTRATEGKWEVLIGSSHILTPTRFLDDLKTLDQKLEGVALP
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcgcccttggggctgaaggcggtggtaggggaaaaaattttaagcggcgtcatccgg
agcgttaagaaggatggcgagtggaaggtcctcatcatggatcacccgagcatgcgaatc
ttgtcatcctgttgtaaaatgtcagatatcctggcggagggcatcaccatcgtggaagac
atcaacaaacggagagaacccattcccagcttggaggcaatttatttgctgagtcccacg
gagaagtcggttcaggccctgattgcggacttccagggaacaccaaccttcacctacaaa
gcagcccatatcttcttcactgacacatgccctgagcccttgttcagtgaactgggccgc
tctcgcctggcgaaggcggtgaagacattgaaagagatccaccttgccttcctcccctat
gaggcccaggtgttctctctggatgccccacatagcacctacaacctttactgtccattc
cgagcaggggagcgggggcggcagctcgatgcactggcccagcagatagccacactgtgt
gccactcttcaggaatacccatccatccgataccgcaagggtccagaagacacagcccag
ctggcccatgctgtcctggccaagctgaacgccttcaaggcagacactcccagtctgggc
gagggcccagagaaaacacgctcacagctactcataatggaccgggcagcagaccccgtg
tccccactattacacgaactcacgttccaagccatggcctatgatcttctggacatcgaa
caggacacatacaggtatgagaccacagggctgagtgagtcccgggagaaggctgtcctc
ctggatgaagatgatgacctgtgggtggaacttcggcacatgcacatagcagatgtttcc
aagaaggtcacagaactcctgaagacattctgtgagagtaagaggctgaccacagacaag
gccaacatcaaagacctgtcccacatcctgaaaaagatgccacagtatcagaaggagctg
aacaagtactctacgcacctgcatttggcagatgactgcatgaagcatttcaagggctcg
gtggagaagctgtgcagtgtggagcaggacctggccatgggctctgatgcagagggtgag
aagatcaaggacgccatgaagctgattgtcccggtgctgctggatgcctcggtgccaccc
tacgacaagatccgggttctgttgctctacatccttctgcggaatggggtgagtgaggag
aacctggccaagctgatccagcatgccaacgtgcagtcgtacagcagcctcatccggaat
ctggagcagctgggcggcactgtcaccaactccgcgggctcagggacctctagccggctg
gagcggagagagcgcatggagcccacctaccagctgtctcgctggtccccagtcatcaag
gatgtgatggaggatgtggtggaggaccggctagaccgaaagctgtggccctttgtgtct
gaccctgcccctgtgcctagctcccaggcagctgtcagcgctcgctttggccactggcac
aaaaacaaagctggagtagaggcccgggctgggcctaggctcatcgtgtacattgtgggt
ggtgtcgccatgtcggaaatgagggctgcctatgaggtgaccagggccactgagggcaag
tgggaggtgctcataggctcttctcacatccttactccaacccgcttcctcgatgacctc
aagacactggatcagaagctggagggtgtggccctgccctga

DBGET integrated database retrieval system