KEGG   Mus musculus (mouse): 20912Help
Entry
20912             CDS       T01002                                 

Gene name
Stxbp3, Munc-18c, Stxbp3a, Sxtbp3, Unc18-3
Definition
(RefSeq) syntaxin binding protein 3
  KO
K15301  syntaxin-binding protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20912 (Stxbp3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20912 (Stxbp3)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    20912 (Stxbp3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   20912 (Stxbp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec1 SGT1
Motif
Other DBs
NCBI-GeneID: 20912
NCBI-ProteinID: NP_035634
MGI: 107362
Ensembl: ENSMUSG00000027882
Vega: OTTMUSG00000007265
UniProt: Q60770
Structure
PDB: 

Position
3; 3 F3
AA seq 592 aa AA seqDB search
MAPPVSERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGIT
VIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFN
KIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQ
IVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDR
GFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVV
LEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKL
NIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTE
ENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKD
IMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIGGI
TYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFKDE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgccggtatcggagcggggactgaagagcgtcgtgtggcggaagataaaaaca
gccgtgttcgatgactgccggaaagaaggcgaatggaagataatgctgttagatgagttt
accaccaaacttttgtcgtcatgctgcaaaatgacagaccttctagaggagggcataact
gttatagagaatatttataagaatcgtgaacctgtcagacaaatgaaagctctttatttc
atctctccaacaccaaaatctgtagattgtttcttgagagattttggaagtaaatctgag
aaaaaatacaaagcagcgtatatatacttcactgacttttgtcctgacagtctctttaac
aagattaaagcatcttgctccaagtcaataagaagatgtaaggaaataaacatttccttc
attccacaggaatctcaggtttatactcttgatgtaccggacgcattctattactgttac
agtccagaccctagtaacgccagcaggaaagaagtggtcatggaggcaatggctgagcag
attgtgacagtgtgtgccactctggatgaaaaccctggagtgaggtacaagagtaaacct
ctagataatgccagtaagcttgcacagctggttgagaaaaagcttgaagactactacaaa
attgatgaaaaaggcctaataaagggtaaaactcagtcccagctcttaataattgaccgt
ggctttgaccctgtgtccactgtcctgcatgaactgacctttcaggcaatggcatatgat
ctactaccaattgagaatgatacatacaagtacaaaacagatggaaaagagaaggaggca
gttcttgaagaagacgacgacctgtgggtgcgggttcgacaccggcacatcgcggttgtg
ttggaggaaattccaaagcttatgaaggaaatttcatcaacaaagaaagctacagagggg
aagacatcacttagcgctcttacccagctgatgaaaaagatgccgcacttccgaaagcag
atctcgaagcaagtagtccatcttaacttagctgaagactgcatgaataagtttaagctg
aatattgagaagctctgcaaaactgagcaggacctggcacttggaacagatgctgaaggc
cagcgggtgaaggactccatgctggtgctcctcccagtgctgctcaacaaaaaccatgac
aactgcgacaaaatacgggcagtcctgctctacatcttcgggattaatggaaccactgaa
gaaaatctggacagactgatccacaatgtaaagatagaagatgatagtgatatgattcgt
aactggagccaccttggtgttcccattgttcccccatcccagcaagccaaaccactgaga
aaggatcggtctgcagaagagacttttcagctttctcgatggacaccttttatcaaagat
atcatggaggatgccattgataatagattagattccaaagagtggccgtattgttcccgg
tgcccagcagtgtggaatggctctggagctgtgagtgctcgccagaaacccagaactaac
tacttagagctggaccggaaaaatgggtcaaggctgattatttttgtaattggaggaatt
acgtactctgagatgcggtgtgcttatgaagtttcccaggcacataaatcctgtgaggtt
attattggttccacacatattttaacacccagaaagctcctggatgatataaaaatgctg
aataaatcaaaggataaagtttcctttaaggatgagtaa

DBGET integrated database retrieval system