KEGG   Mus musculus (mouse): 20916
Entry
20916             CDS       T01002                                 

Gene name
Sucla2, 4930547K18Rik, A-SCS, SCS-betaA
Definition
(RefSeq) succinate-Coenzyme A ligase, ADP-forming, beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    20916 (Sucla2)
   00640 Propanoate metabolism
    20916 (Sucla2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20916 (Sucla2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     20916 (Sucla2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     20916 (Sucla2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20916 (Sucla2)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Other DBs
NCBI-GeneID: 20916
NCBI-ProteinID: NP_035636
MGI: 1306775
Ensembl: ENSMUSG00000022110
Vega: OTTMUSG00000035022
UniProt: Q9Z2I9
Position
14; 14 D3
AA seq 463 aa
MAASMFYGRQLAAAALRSHRPQTTLRAAAQVLGNSGLFNKHGLQVQQQQQRTLSLHEYLS
MELLQEAGVSVPKGFVAKSSDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFTSGLKGGVK
IVFSPEEAKAVSSQMIGQKLITKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP
VLIGSAQGGVNIEDVAAENPEAIVKEPIDIVEGIKKEQAVTLAQKMGFPSNIVDSAAENM
IKLYNLFLKYDATMVEINPMVEDSDGKVLCMDAKINFDSNSAYRQKKIFDLQDWSQEDER
DKEAANADINYIGLDGSIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVQQVTEA
FKLITSDKKVQAILVNIFGGIMRCDVIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKALI
ADSGLKILACDDLDEAAKMVVKLSEIVTLAKEAHVDVKFQLPI
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggcgtccatgttctacggccggcagttggccgcggccgccctgaggagccaccgg
ccgcagactacgctgcgagccgccgcccaggttctgggaaattctggcttgtttaacaag
catggactacaagtgcagcagcagcagcagaggaccctttcgctgcatgaatacttgagt
atggagttattgcaggaagcgggtgtctctgttcccaaaggcttcgtggcaaagtcatcc
gatgaagcttacgcaattgccaaaaaattaggatcaaaggatgttgtgataaaggcacag
gttttggctggcggcagaggaaaaggaacatttacaagtggcctcaaaggaggagtgaag
attgttttctctccagaagaagcaaaagctgtttcctcacagatgattgggcaaaaattg
attaccaagcaaactggagaaaagggcagaatatgcaatcaagttttggtctgtgagcgc
aaatatcccaggagagaatactactttgcaataacaatggagaggtcatttcaaggtcct
gtactgataggaagtgcacaaggtggtgttaacattgaagatgtggctgccgagaaccct
gaagccattgtaaaggagcctattgatatagtggagggcatcaaaaaggaacaagccgtg
acacttgcacagaagatgggatttccttctaacattgtggactctgcagcagaaaacatg
atcaagctttataatctttttctgaagtatgatgcaactatggtagaaataaacccaatg
gtagaagattctgacggaaaggtgttgtgcatggatgcaaagatcaattttgattcaaat
tcagcctaccgccagaagaagatctttgatcttcaggactggagtcaggaagacgaaagg
gacaaagaagcagctaatgcagatattaactacatcggcctcgatgggagcataggatgt
ctagtaaatggtgctggcttggctatggccacaatggatataataaaactacacggaggg
actccagccaactttcttgatgttggtggaggcgccacagtccagcaagtaacagaagcg
tttaaactcatcacttcagataaaaaggtgcaggctattctggtcaacatttttggagga
atcatgagatgtgatgttattgcacaaggaatagtcatggcagtaaaggatttagaaatc
agaatacctgttgtggtgcggttacaaggtacacgagttgatgatgctaaggcactaata
gcagacagtggtcttaaaatccttgcttgtgatgatttggatgaagctgctaaaatggtt
gtaaagctctctgaaatagtgaccttagccaaagaagcccatgtggatgtgaagtttcaa
ttgccaatatga

KEGG   Mus musculus (mouse): 20917
Entry
20917             CDS       T01002                                 

Gene name
Suclg2, AF171077, AW556404, D6Wsu120, D6Wsu120e, G-SCS, GTPSCS, SCS-betaG
Definition
(RefSeq) succinate-Coenzyme A ligase, GDP-forming, beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    20917 (Suclg2)
   00640 Propanoate metabolism
    20917 (Suclg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20917 (Suclg2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     20917 (Suclg2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     20917 (Suclg2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20917 (Suclg2)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp DUF3141
Other DBs
NCBI-GeneID: 20917
NCBI-ProteinID: NP_035637
MGI: 1306824
Ensembl: ENSMUSG00000061838
Vega: OTTMUSG00000057813
UniProt: Q9Z2I8
Position
6 D2; 6 44.63 cM
AA seq 433 aa
MASPVAIAAQAGKLLRERALRPLLAVRSQAGHLTPRRWLNLQEYQSKKLMSEHGVRVQRF
FVANTAKEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPKVVGELAQQ
MIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSHNGPVIVGSPQGGVDIEE
VAASSPELIFKEQIDIFEGIKDSQAQRMAENLGFLGSLKNQAADQITKLYHLFLKIDATQ
VEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAARYDLKYIGL
DGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYEAFKLLTSDPKVEAIL
VNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQNILKSSGLPITSAVDLE
DAAKKAVASVAKK
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgtccccggtggccatcgcggcgcaggctgggaagcttctgcgagagcgagcgctg
cggccgctcctggcggtcaggtcccaggccggtcacttaaccccccgaagatggctgaac
ctgcaggagtaccagagcaagaagctcatgtcagagcacggagtgagagtgcagaggttc
tttgttgccaacactgctaaagaggctctggaggcagccaagagattgaatgcaaaagaa
attgttttaaaagcccagatcttagctggaggaagaggaaaaggtgtcttcaatagcggt
ttgaaaggaggtgttcatttaacaaaagaccctaaagtagtgggagagttggctcaacag
atgattggttataatctagcaacgaaacaaactccaaaagaaggtgtgaaagttaacaag
gtgatggttgctgaagccctggatatttctagagaaacatacttggccattctaatggac
cggtcccataatggccctgtgatagtgggcagtcctcaggggggcgttgatattgaggaa
gtggcagcttccagtccagaactcatctttaaggagcagattgacatctttgaagggata
aaggatagccaggcccagcgcatggcagaaaatctgggcttccttgggtctctgaaaaac
caggctgcagatcagattacaaagctgtaccatctcttcctgaagattgatgccactcag
gtggaagtgaaccccttcggtgaaactccagaaggacaagttgtctgttttgatgccaag
ataaactttgatgacaatgctgagttccgacaaaaggacatatttgctatggacgacaaa
tccgagaatgagcccattgaaaatgaagctgccagatacgatctcaagtatataggactg
gacgggaacattgcctgcttcgtgaatggtgctgggctggccatggctacctgcgacatc
atcttcctgaacggagggaagccagcgaacttcttggaccttggaggtggtgtaaaggaa
gcccaagtctatgaagcattcaaactgctcacgtctgaccccaaggtggaagccattctc
gtcaatatctttggtgggatcgtcaactgtgccatcattgccaacggaatcaccaaagcc
tgccgggagctggagctcaaggtgccactggtagtccggcttgaaggaactaatgtgcag
gaggctcagaatatcctcaagagcagcggactccccatcacgtcagctgtggacctggag
gatgcagccaagaaagctgttgccagtgtggcaaagaagtga

KEGG   Mus musculus (mouse): 56451
Entry
56451             CDS       T01002                                 

Gene name
Suclg1, 1500000I01Rik, Suc, Sucla1
Definition
(RefSeq) succinate-CoA ligase, GDP-forming, alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    56451 (Suclg1)
   00640 Propanoate metabolism
    56451 (Suclg1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     56451 (Suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     56451 (Suclg1)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-GeneID: 56451
NCBI-ProteinID: NP_063932
MGI: 1927234
Ensembl: ENSMUSG00000052738
Vega: OTTMUSG00000023469
UniProt: Q9WUM5
Position
6; 6 C1
AA seq 346 aa
MTATVVAAAATATMVSSSSGLAAARLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIIC
QGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYV
PPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHRLTRQGTTRLIGPNCPGVINPGE
CKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCL
EVFLNDPATEGIILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHA
GAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaccgcaacagtagttgctgcggctgccactgcaaccatggtctccagcagcagcggc
ctcgccgccgcccgcctgttgtcgcgcaccttcctcctgcaacagaatgggatacgacac
gggtcttacacagcctctcggaaacatatctatattgataaaaatacgaagattatttgc
cagggtttcacaggcaaacagggtacctttcacagtcagcaggctttggagtacggcacc
aaactcgtgggaggaaccactccagggaagggtggccagaagcacctgggcttgcccgtc
tttaatactgtgaaggaagccaaagagaaaacaggagcaacggcttctgtcatctatgtc
cctcctccttttgctgctgctgccattaatgaagcaatcgacgcggagattcccttggtt
gtgtgcattacggaaggtattccgcagcaggatatggtgcgggtcaagcacagactgaca
cgccagggaacgacgaggctaatcgggccaaactgccccggcgtcatcaaccctggagaa
tgcaaaatcggcatcatgcctggccacattcacaagaagggaagaataggtatcgtgtcc
aggtccggtactctgacttatgaagcagttcaccaaacaacccaagtcggattggggcag
tccttgtgtattggcattggaggtgacccttttaatgggactgattttattgattgcctt
gaagtcttcctgaatgatccagccacagaaggcatcatactgattggtgaaattggtggt
cacgctgaagaaaatgctgccgcgtttctgaaggagcataactcaggtccaaaggccaag
cctgtagtgtccttcattgctggtataactgctcctcctggcagaaggatgggccatgca
ggggcaattattgctggaggaaaaggtggcgctaaagagaagatctctgctcttcagagt
gctggggtggttgtcagcatgtcccccgcacagctgggaactaccatttataaggagttt
gaaaagaggaagatgctttga

DBGET integrated database retrieval system