KEGG   Mus musculus (mouse): 209195
Entry
209195            CDS       T01002                                 

Gene name
Clic6, 5730466J16Rik, AL022908, AW045520, CLI, CLIC1L
Definition
(RefSeq) chloride intracellular channel 6
  KO
K05026  chloride intracellular channel protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    209195 (Clic6)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   209195 (Clic6)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_C_3 DUF1533
Other DBs
NCBI-GeneID: 209195
NCBI-ProteinID: NP_766057
MGI: 2146607
Ensembl: ENSMUSG00000022949
Vega: OTTMUSG00000028529
UniProt: Q8BHB9
Structure
PDB: 
6ERY 6ERZ

Position
16; 16 C4
AA seq 596 aa
MAEATEPKEVAPGSQGQPEGATIEGPGEPGAADLEGREASEEAAEAPRDLGAGVEARASG
KEEGGCGQDEGTGGAQAQDPRTGPEAETPGASGAPGEAEAAERDPEGAIPQGAEEAPSAQ
QVQGMSSGLDSQGEAPEVPGDSRREPEDPTASEAGEEAESGQEAQGGGALGLQINPEVQG
LAGDNMDTEAPAGGPLGSESEPQGGGESSPQPQDEAIEIVTTEIGGNESGELAGASAADA
AGEGETLGKDGSEEAASEDARVDAHENGDQGKLQEETGEEEARPEPELKGPCEGAIQEKP
PDGSLDGEEAKSTEHEEESQAELSNHLAEEPSVQGGEELGRVNGRRENGPALEEGDPGQE
HDITLFVKAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPP
FMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDA
NEIYEKNLLRALKKLDSYLNSPLPDEIDADSSEDVTVSQRKFLDGDELTLADCNLLPKLH
IIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADREIEHAYSDAAKRMK
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggctgaggccacggagcccaaggaggtcgctccaggttcccaggggcaacccgaaggt
gcgacaatcgagggaccaggagagccaggagctgcggacctggaggggcgggaagcgagc
gaggaagctgcagaggcacctagggacctgggggcgggcgtagaggccagggcctcgggg
aaggaggaaggaggctgtgggcaggacgagggaactgggggagcgcaggcgcaggacccg
cgcaccggccctgaggccgagacgccgggcgccagcggagctccaggtgaagcggaggct
gcggagcgcgaccccgagggcgcgatcccgcagggagcggaggaggcgccaagcgcccag
caggtgcaggggatgagctctgggttagactctcagggtgaggcccccgaggtccctggg
gactctcgccgggagcccgaggaccccacggcctcagaggcaggggaagaggcagaatct
ggtcaggaagcgcagggaggcggcgcgctagggttgcagatcaacccagaagtccaggga
cttgcaggggacaacatggacacagaggcacccgcaggagggccacttgggtcggagagt
gagccccagggtggaggggaaagcagccctcagccccaggatgaggcgattgagattgta
accacagagatcggagggaacgagtccggggagctggcgggcgcttcggccgcagacgcc
gcgggggaaggggagaccctggggaaagacgggtccgaggaagcagcttccgaggatgcg
agagtagatgctcatgagaatggggaccagggcaagctccaggaggagaccggggaggaa
gaagcgaggccagaacccgagttgaagggaccctgcgagggggccatccaagagaagccc
cccgacggcagccttgatggagaggaggccaaatccaccgaacacgaggaggaatcccag
gcagagctcagcaaccacttagctgaggagcccagcgtccagggtggagaagagttgggg
cgagtgaacggccgcagggagaatggcccagcattggaggagggggatccgggacaggag
cacgacatcaccctcttcgtcaaggctggttatgacggcgagagcatcggaaactgccca
ttttcacagcgtctctttatgatcctctggctaaagggtgttatattcaatgtgacaacg
gtggacctaaaacggaagcctgcagaccttcagaacctggctcctgggacgaaccctcct
ttcatgacttttgatggtgaagtcaagacagatgtgaataaaattgaggagttcttagag
gagaagttagttcccccgaggtaccctaagctgggaactcagcaccctgagtccaactca
gcgggaaatgatgtttttgccaaattctcagcatttattaaaaacaccaagaaggatgca
aatgagatttatgaaaagaacctactacgggccctgaagaagctggacagttacttaaac
agcccgctgccagacgaaatcgatgccgacagttcagaggatgtcactgtttcacaaagg
aagtttctggatggggatgagctcacactggctgactgtaacctcttacccaagctccat
atcattaagattgtcgccaagaaatatagagattttgagtttccttctgaaatgaccggc
atttggaggtacttgaacaacgcttacgcccgggatgagttcactaacacgtgtccggcc
gaccgggagattgaacacgcatattccgatgcagcgaaaaggatgaagtga

DBGET integrated database retrieval system