KEGG   Mus musculus (house mouse): 209200
Entry
209200            CDS       T01002                                 
Symbol
Dtx3l
Name
(RefSeq) deltex 3-like, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    209200 (Dtx3l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    209200 (Dtx3l)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     209200 (Dtx3l)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    209200 (Dtx3l)
SSDB
Motif
Pfam: DTC zf-C3HC4_2 zf-RING_2 zf-C3HC4 zf-C3HC4_3 zf-RING_6 zf-rbx1 zf-RING_5 zf-RING_UBOX Baculo_IE-1 zf-RING_4 zf-RING_10 DZR_2
Other DBs
NCBI-GeneID: 209200
NCBI-ProteinID: NP_001013389
MGI: 2656973
Ensembl: ENSMUSG00000049502
UniProt: Q3UIR3
Position
16:complement(35746885..35759397)
AA seq 748 aa
MASSPDPPSPLLVRLRESIPKAHRKLEIYFQSRASGGGECSVQPVGPSAPDTYEVKFLKK
ADKEKVLKKSEHEMLVHNKPVTIVLETTKKPVEDLRPRLPSLTQPVETPSSRPPSLTGSL
DEALCDDIHPQDGLVSNSVDSVVQKIFLAVTAELNCDLLSKEQRASITTVCPHIIKSMEG
SDGIKKVCGNFKDIEKIHHFLSEQLLEREQKRKGSEQKRKCAPQKHTPPDVEREPPDQSS
IQVPVLLLEYFKHVNPGRLEFIEYKFGVNIEIQASSPNMVTVGFTSSPFGNVEEASQSFV
RDFQKCSQSLKQDCISLEEHQRAKEVRQELSRCFPKLLIKGQGRTLTLLGSPADISAATE
KVSQGLGLRPVKITASGYTTGIEVDSTRFKLLEPELLQEISEIEQKFNTRGKVQEKGQKT
CILFVPKDKDLDLSVQSYTGFTDAFQRATWQLRTEVLSLKGLGKERARLHNTKFADNFKK
EHPNVHFVTSQESVTLTGLPHHLAQAMQYVSKRMGLAPSSGEKLAMDQETPMEISSSDPH
GDQQENAALPAPRGTSSSPAASKGTEDYCVICMDTISNKHVLPKCKHEFCTSCISKAMLI
KPVCPVCLTSYGIQKGNQPEGTMSYSTQKGSLPGYEGCGTIVINYEIKDGIQTKEHPNPG
KAYHGTRRTAYLPDNTEGRKVLDLLHEAFKHRLTFTIGYSRATGVSDVITWNDIHHKTSK
FGGPANFGYPDPDYLKRVKEELKAKGIE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggcttccagtcccgacccgccgtccccgctactcgtacggctgcgggagtccatcccc
aaggcgcacaggaagctcgagatatacttccagagccgggcctcgggaggtggggagtgc
tctgtccagcccgtgggccccagcgccccggacacctacgaggtgaagttcctaaaaaaa
gcagataaggagaaagtgttgaaaaagagcgaacacgagatgttggtccataacaaacct
gtgaccattgtcctggaaactactaaaaagccagtagaggacctgagacccagactccca
tccttgacacagccagtggagacaccaagctccagacctccgtccttgacggggtctctg
gatgaagcactttgtgatgacatacatccccaggacgggctcgtttctaactctgttgac
tcagttgtccaaaagatctttcttgctgtgaccgctgagctgaactgtgacctgctctct
aaagagcagagagcatctataaccactgtctgccctcacatcatcaaaagcatggagggt
agtgatggaattaagaaggtgtgtggcaacttcaaagatattgaaaagatacatcacttc
ttgagtgagcagcttttggaacgggagcagaaacggaagggaagcgagcagaaacggaag
tgcgccccacagaaacacacacctcccgatgtggagcgggagccccctgatcagagcagt
attcaagttcctgtgcttctccttgaatatttcaagcatgttaatccgggtagactagag
ttcatagagtacaaatttggtgtaaacattgaaatccaagctagttctcccaatatggtc
actgtaggcttcacctccagcccatttggcaacgtagaagaagcaagtcagtcctttgtc
agagactttcagaaatgctcgcagtctctgaagcaagattgtatctctttagaggagcac
cagagagcaaaggaggtcagacaggagctgagtcgctgcttcccaaagctcttgataaag
ggacagggaagaacgctgactctcctcggctctcctgctgacatttcagccgccacagaa
aaagtctcccaaggtcttggcctgagacctgtgaaaataaccgcatctgggtacacgacg
ggcatcgaggtcgattcaacacgctttaagcttctagagcctgaactgctccaggaaatc
tcagagatcgagcagaagtttaacacccgtggcaaagtccaggaaaaaggccagaaaacc
tgcattctttttgtccccaaggataaagacttagacctgtcagtgcagtcctacacaggt
tttactgatgccttccagcgtgccacgtggcagctgaggacagaagttctgtcgctgaaa
gggttgggcaaggagagagctcgcttacacaataccaagtttgccgacaactttaaaaaa
gagcacccgaatgtgcactttgtgacatctcaggagtcagtgaccttgactggcttgcca
catcaccttgcgcaggcaatgcagtatgtctccaaaagaatgggactggcaccgtcatct
ggagagaaactcgctatggatcaggaaacccccatggagatcagcagtagtgacccccat
ggagatcagcaggagaatgcagccttacctgctccccgaggcacctctagcagccctgca
gcttcgaaggggactgaggactactgtgtcatctgcatggataccatcagcaacaagcac
gtgctccccaagtgcaagcatgaattctgcacctcgtgtatcagcaaagccatgcttatc
aagcctgtctgtcctgtgtgtctgacttcctacggcatccagaaagggaaccagccagag
ggaaccatgtcttactccactcaaaaagggtcacttccaggttatgaaggctgtggcacc
attgtgattaattatgaaataaaagatggcatccaaacaaaagagcacccaaacccagga
aaggcttatcatggaacacggcgaactgcatacttgcctgataatactgagggaagaaag
gttttggatctgctccacgaagcctttaagcacagactgactttcacaataggatactct
cgagcaacaggagtctcggatgtcattacatggaatgatattcatcacaaaacatccaag
tttggaggaccagcaaattttggctaccctgatcctgattacctgaaacgtgtcaaggag
gagctgaaagcaaaaggcattgagtaa

DBGET integrated database retrieval system