KEGG   Mus musculus (mouse): 20924Help
Entry
20924             CDS       T01002                                 

Gene name
Supt5, AL033283, AL033321, AU019549, Spt5, Supt5h
Definition
(RefSeq) suppressor of Ty 5
  KO
K15172  transcription elongation factor SPT5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20924 (Supt5)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    20924 (Supt5)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     20924 (Supt5)
  RNA polymerase I system
     20924 (Supt5)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    DRB sensitivity inducing factor (DSIF) complex
     20924 (Supt5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KOW Spt5-NGN Spt5_N DUF3912 Ribonuc_P_40
Motif
Other DBs
NCBI-GeneID: 20924
NCBI-ProteinID: NP_038704
MGI: 1202400
Ensembl: ENSMUSG00000003435
Vega: OTTMUSG00000059053
UniProt: O55201
Position
7 A3; 7 16.68 cM
AA seq 1082 aa AA seqDB search
MSDSEDSNFSEEEDSERSSEAEEAEVEEDQRSAAGSEKEEEPEEEEEEEEEYDEEEEEED
DDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGA
RRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTV
KCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGV
GNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNT
ISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFE
GNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNFQP
GDNVEVCEGELINLQGKVLSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIA
GRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQL
DPRTVGVIVRLERETFQVLNMHGKVVTVRHQAVTQKKDNRFAVALDSDQNNIHVKDIVKV
IDGPHSGREGEIRHLYRSFAFLHCKKLVENGGMFVCKARHLVLAGGSKPRDVTNLTVGGF
TPMSPRISSPMHPSAEGQHGGFGSPGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKD
ATESTARVELHSTCQTISVDRQRLTTVDSQRPGGMTSTYGRTPMYGSQTPMYGSGSRTPM
YGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTP
SPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSP
SPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPH
TPGSGIEQNSSDWVTTDIQVKVRDTYLDTQIVGQTGVIRSVTGGMCSVYLKDSEKVVSIS
SEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIIRMDLEDQQIKILNLRFLGKLL
EA
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacagcgaagacagcaacttctccgaggaggaggacagcgagcgcagcagcgag
gcggaggaggccgaggttgaggaagaccagcgaagtgctgcaggcagtgaaaaagaggag
gagcctgaggaagaggaggaggaagaggaagaatacgatgaggaagaagaggaggaagat
gatgataggccccccaagaaaccacgccatgggggcttcattttagatgaggctgatgta
gatgatgaatatgaagatgaagaccagtgggaagatggagctgaagatatcctggagaaa
gaagagattgaagcctccaatattgataacgttgtgctggatgaagaccgctctggggct
cgtcgtctgcagaatctctggagggaccagagagaagaagaactgggcgagtattacatg
aagaaatatgctaagtcgtctgtgggagagacggtgtatggagggtctgacgagctctca
gatgacatcactcagcagcagctgctcccaggagtcaaggaccccaacctgtggactgtc
aagtgtaagattggggaggaacgagccacggcaatttccttgatgcggaaattcatcgct
taccagttcacagacacacccctgcagattaagtcagtggttgcccctgagcacgtgaag
ggctacatctatgtggaggcctacaaacagacccatgtgaagcaggccattgaaggtgtg
ggcaacctgcggcttggctactggaaccagcagatggtgcctattaaggagatgaccgat
gtactcaaggtggtgaaggaggtggccaacctgaagccgaagtcctgggtccgcctcaag
cgaggcatctacaaagatgacattgctcaggtggactatgtggagcccagccagaacacc
atttccctgaagatgatcccgcgcatcgactacgaccgcatcaaagcccgaatgagcctg
aaagactggtttgccaaaaggaagaagttcaagcggcctccacagaggctctttgatgca
gagaagatcaggtccttggggggtgatgttgcctctgatggtgacttcctcatctttgag
gggaaccgctacagccgaaagggcttcctgttcaagagctttgccatgtctgctgtgatt
acagaaggtgtgaagcccacactgtcagagctggaaaagtttgaagatcagcctgagggc
atcgacctggaggttgtgactgaaagcacagggaaggagcgggaacacaatttccagcct
ggggacaatgtggaggtgtgcgagggcgagctcatcaacctacagggcaaggtcctcagc
gtggatggcaacaagatcactatcatgcccaagcacgaggacctcaaggacatgcttgag
ttccccgctcaggaacttcggaagtacttcaagatgggggaccacgtaaaagtgattgct
ggccgatttgagggtgacacaggtctcattgtgcgggtggaagagaactttgttattctc
ttttcagacctcaccatgcatgagttgaaagtgcttccccgagacctgcagctctgctca
gagacagcctcaggcgtggatgttgggggccagcatgagtggggtgagctggtgcagctg
gatccccgtactgtgggtgtcatcgtgcggctagagcgagaaaccttccaggttctcaac
atgcacgggaaggtggtgaccgttaggcaccaggccgtgacgcagaagaaggacaaccgc
ttcgctgtggctctggactcggatcagaacaacatccatgtgaaggacattgtcaaggtc
atcgatggccctcactcaggccgagagggtgagatccgccatctgtaccgcagctttgcc
ttcctgcactgcaagaagctggtggagaacggcggcatgtttgtctgtaaggcacggcac
ctggtgttggctgggggctcaaagccccgggatgtgaccaatttaactgttggtggcttc
actcctatgagcccccggatcagcagccctatgcaccccagtgctgaaggtcagcatggt
ggctttggaagcccaggtggcatgagcaggggtcgagggagaagagacaatgaactcata
ggccagactgtgcgtatctcccagggaccctacaaaggctacattggtgtggtgaaggat
gccacagagtccacggccagagtagaactgcattctacctgccagaccatctctgtggat
cgccagcggctcaccacggtcgactcccagcgtccaggtggcatgacctctacatatgga
cggactcccatgtatggctctcagacacccatgtatggctctggctcccgaacacctatg
tatggctcccagacacctttgcaggatggcagccgcactccacattatggctcacagaca
cccctgcatgatggtagccgcactcctgctcagagtggggcctgggaccccaacaaccca
aacacgccttccagggctgaggaggaatacgaatatgcctttgacgacgaacccacccca
tccccacaagcatatgggggaaccccgaatccccaaacacccggctacccagacccatca
tccccccaggtcaatccacagtacaatccacagacaccagggacgccagccatgtacaac
acagaccagttctccccctacgctgccccctctccacaggggtcttaccagcccagcccc
agcccccagagctaccaccaagtggcaccaagtccagcaggctatcagaacacccattcc
ccagccagctatcacccgacaccgtcacctatggcctatcaggctagtcccagcccaagc
cctgttggctacagtccaatgacccctggagcaccttctcctggaggttacaatccccac
acaccgggctcaggcattgagcagaactctagcgactgggtgaccactgatatccaggtg
aaggttcgagacacctatctggacacacaaatagtggggcagacaggcgtcatccgcagt
gtcacgggaggcatgtgctccgtgtacctgaaggacagtgagaaggtggtcagcatctcc
agtgaacatctggagcccatcacgcccaccaagaacaacaaggtgaaggtgattctgggt
gaggaccgagaggctaccggggtcctactgagcattgatggtgaggatggcatcatccgc
atggacctagaggaccagcagatcaagattctaaacctccgcttcctagggaagctcctg
gaagcctga

DBGET integrated database retrieval system