KEGG   Mus musculus (house mouse): 209334
Entry
209334            CDS       T01002                                 
Symbol
Gen1, 5830483C08Rik
Name
(RefSeq) GEN1, Holliday junction 5' flap endonuclease
  KO
K15338  flap endonuclease GEN [EC:3.1.-.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    209334 (Gen1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     209334 (Gen1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     209334 (Gen1)
SSDB
Motif
Pfam: XPG_I Chromo_2 XPG_N
Other DBs
NCBI-GeneID: 209334
NCBI-ProteinID: NP_796305
MGI: 2443149
Ensembl: ENSMUSG00000051235
UniProt: Q8BMI4
Position
12:complement(11288929..11316030)
AA seq 908 aa
MGVNDLWQILEPVKQHIHLQDLSGKTIAVDLSLWVCEAQTVKKMIGTVKKPHLRNLFFRI
SYLTQMNVKLVFVMEGEPPMLKADVISKRTQTRYGPSGKSRSQKTGRSHFKSVLRECLEM
LECLGMPWVQAAGEAEAMCAYLNASGHVDGCLTNDGDAFLYGAQTVYRNFTMNTKDPHVD
CYTISSIKSKLGLDRDALVGLAVLLGCDYLPKGVPGVGKEQALKLLQIFKGQSLLQRFNQ
WIEDPCYSVPQSAPKKVVHCSVCSHPGSPKDHERNGCILCKSDKYCEPHDYDYLCPCEWH
QTDHNRHLSEIENNIKKKACSCEGFPFHEVIQEFLLNKNKMLKPITYQRPDLLLFQRFTV
QKMEWPSHYACEKLLVLLTRYDMIERKHGRKTSNQLQPIRIVKPRVRNGVHCLEIEWEKP
EHYVVEDGDPGKLSLLTMEEASLFEAAYPDAVAVYQKQLSETKGRKQKSMKNKPKGSHLP
EADDVINSQSLMTLKPTSKAFPKQNPKINLENSPDPILAQESTSPSLNSFVSPENAPCLN
LQEQLVPSPRTLAIKQSKDVSHFLVSECSQPSSSSHDISVITDLQLSTIDWAGTSFSNSP
AVQRNTFSQDLASESESSAILPDFEQLSYESEQGTSDSEGSGRDLQQSNPEEQLLSGISA
LHLHDLPLKERIRIKSSCPQYNVGADAGLESLPLKLKGSCIAYSSSDGSSNFSKDLTGVY
LHKESRNSKVLDSRLQENCGANTSLPYSFSDKAVKTSSLQVGLPTAAIPHNPRVAVKTTK
NLVMKNSVCLERDSSDEDNAPGSWKSKYTAPEMKHSSQKHSLVHVRDSTHNKLRNPKVES
KETKLCNESFKTAEDEENGFSDLGRSPQSFRPCHDKDENSTASWENPLPLRQRLKLRFQN
TQSGFYNT
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgggagtgaatgacttatggcaaattctagagcctgtaaagcaacatatccacttgcaa
gatcttagtgggaaaaccattgccgttgatttgagtctctgggtatgcgaggcacagaca
gtgaagaaaatgataggaactgtcaagaagccccacctcaggaacctattttttcgtatt
tcatatttaactcaaatgaatgtaaaactggtgtttgtaatggaaggggagccaccaatg
ctgaaagctgatgtcataagcaagaggactcagactcgttacgggccttctggaaaatca
aggtctcagaaaacagggagatcacattttaagtcagtcttacgagagtgccttgaaatg
ctcgagtgcctgggaatgccctgggtccaggccgccggggaagctgaggccatgtgtgct
taccttaatgccagtggccatgtggatggctgcctcaccaacgacggcgatgctttcctt
tatggagcccagactgtttacagaaatttcacgatgaacacaaaggatccccatgttgac
tgttacacgatatcatctatcaagagtaagctaggcttggatcgagacgctctggttgga
ctggccgtacttctgggttgtgattaccttccaaagggagtgcctggagttggaaaggaa
caagcattaaaacttttgcagattttcaaaggtcaaagtttgcttcagaggtttaaccag
tggattgaagacccttgctactctgttccacaatcagcaccaaaaaaagtggttcactgc
tctgtgtgttcccacccaggttcgccaaaggatcatgaacgtaatggatgcatattatgt
aaaagtgataaatactgtgaaccacatgattatgattacctctgcccttgtgaatggcat
cagacagaccataataggcatctaagtgaaatagaaaacaatattaaaaagaaagcttgc
agttgcgaaggatttccattccatgaggtcatccaagagttccttttgaataagaataaa
atgttgaaaccgatcacataccaaagacctgatttattattgtttcagagatttactgtt
caaaaaatggagtggcccagtcactatgcatgtgaaaaattgttggtgcttttgacccgc
tatgacatgatagaaagaaaacatggtagaaagacctccaatcaactacagccaattaga
attgttaaaccccgagtcagaaatggagtccattgtcttgaaatagaatgggaaaagcct
gaacattatgtggtggaagatggagaccctggaaaactgagcctccttacaatggaagaa
gcgtccctgtttgaagcagcctatcctgatgctgtggctgtctaccagaaacagctgtca
gagaccaaaggaaggaaacagaaaagtatgaaaaataagcctaaaggaagccatttaccg
gaagcagatgatgtgatcaattctcagtcacttatgactttaaaacctacatctaaagcc
ttccccaagcaaaatcccaaaattaatttggaaaattctccagatcctattttagcacag
gaatctacttccccctcattgaatagttttgtttcccctgaaaatgctccctgtttgaat
ttacaagaacagttagtgccatctcccagaactttggctataaagcaaagtaaagatgtc
agtcattttctagtttcagaatgtagtcagcccagctcttcctcccatgacatctctgtg
attactgatctgcagttgagtaccattgattgggcgggtacttcttttagtaattctcca
gcagttcaaagaaacactttctctcaagacttagcatcagaatctgagtcatcggccatc
cttcctgactttgaacagctgtcatatgaatcagaacaagggacctcagacagtgaaggg
tccggtagagaccttcagcagagcaaccctgaagagcagctcctttctggcatcagtgct
ttacatcttcatgatttgcctctaaaagaaagaatacgtatcaaatcttcatgccctcag
tataatgtaggagcagatgctggcctggaaagtttgcccctaaaattgaaaggctcttgt
attgcttacagtagctctgatggctcatccaatttttcaaaggatcttacaggggtatat
cttcacaaagagtccagaaactctaaagttctagacagccgactccaagaaaactgcggg
gcgaatacttccttaccttattctttcagtgacaaagcagtaaagacttccagtcttcaa
gttgggctgccaactgctgctatacctcataatccaagagttgctgtgaaaactactaag
aaccttgtcatgaagaatagtgtttgcctcgagagagattcctcagatgaagacaatgct
ccagggtcctggaaatcaaagtatactgctccagaaatgaaacacagttctcagaagcac
agcctagtccatgtcagagacagtactcacaacaaactcagaaatcctaaagtggaatct
aaagaaaccaaactgtgtaatgagtcttttaaaacagctgaagatgaagaaaacgggttc
tcagatctagggagaagtcctcagagttttcgaccatgtcatgacaaagatgagaactct
actgcctcctgggaaaatcctctacctttacgccagaggttaaaactcaggttccagaac
actcaaagtggattttataatacttaa

DBGET integrated database retrieval system