KEGG   Mus musculus (mouse): 209354Help
Entry
209354            CDS       T01002                                 

Gene name
Eif2b1, D5Ertd406e, EIF2BA
Definition
(RefSeq) eukaryotic translation initiation factor 2B, subunit 1 (alpha)
  KO
K03239  translation initiation factor eIF-2B subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    209354 (Eif2b1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    209354 (Eif2b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    209354 (Eif2b1)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    209354 (Eif2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B
Motif
Other DBs
NCBI-GeneID: 209354
NCBI-ProteinID: NP_663346
MGI: 2384802
Ensembl: ENSMUSG00000029388
Vega: OTTMUSG00000024473
UniProt: Q99LC8 Q3UZR8
Position
5 F; 5 63.67 cM
AA seq 305 aa AA seqDB search
MEDGELIEYFKSQMKGDPKMASAVAAIQTLLEFLKRDKGETLQGLRANLTYAIKTLCGVD
SSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLRRISLSRNKIANLCHTFIK
DGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALSHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQEDVPDKFKYKADTLKSVQTGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSAVSDEL
IKLYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggtgagttaattgaatactttaagtctcagatgaaaggagatcctaaaatg
gcctcagctgtggctgccatccagactttgttggaattcttgaagagagataaaggagaa
acactccagggcctgagagcaaatctcacctatgccataaaaaccctctgtggtgtggac
tcctcagtggccgtgtcatctggcggggagctcttccttcgcttcatcagcctcacctcc
ctggaatactctgactactccaaatgtaagaagatcatgattgagagaggagagctgttc
ctgagaagaatatccctgtcgagaaataagattgccaatctgtgtcatacattcatcaaa
gacggggcgagaattttgactcacgcctactccagagttgtcttaagagtcctggaagaa
gccgtggcagccaagaaacggttcagtgtgtatatcacggagtcgcagcctgatttatct
ggtaagaaaatggccaaagccctctcccacctcaacgtccctgtcactgtggtgctggat
gctgctgtcggctatatcatggagaaagcagatcttgtcatagttggtgctgaaggagtg
gtagagaacggaggcattattaacaagattggaaccaaccagatggccgtgtgtgccaaa
gcccagaataagcccttctatgtggttgcagaaagcttcaagttcgtacgcctctttcca
ctcaaccaggaggacgtcccagataagtttaagtacaaggcagacactctgaagtctgtg
cagactgggcaggatctcaaagaggaacacccatgggtggactacacctccccatccctc
atcaccctgctgtttacggacctgggtgtgttgacgccatctgctgtaagcgatgagctc
atcaagctgtacctatga

DBGET integrated database retrieval system