KEGG   Mus musculus (mouse): 209361
Entry
209361            CDS       T01002                                 

Symbol
Taf3, 140kDa, 4933439M23Rik, AW539625, TAF140, TAFII-140, TAFII140, mTAFII140
Name
(RefSeq) TATA-box binding protein associated factor 3
  KO
K14650  transcription initiation factor TFIID subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    209361 (Taf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    209361 (Taf3)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     209361 (Taf3)
SSDB
Motif
Pfam: Bromo_TP PHD PHD_2
Other DBs
NCBI-GeneID: 209361
NCBI-ProteinID: NP_082024
MGI: 2388097
Ensembl: ENSMUSG00000025782
Vega: OTTMUSG00000011183
UniProt: Q5HZG4 A2ASY1
Structure
PDB: 
2K16 2K17

Position
2; 2 A1
AA seq 932 aa
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PILDDVGEAFQLMGVNLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KDYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDEMEEEEVINDENFLGKRP
LDSPEVEEMPSMKRPRLLSTKGDSLDVVLLEAREPLSSINPQKTPPVLSPVRVQDRADLA
PPSPQPPMLAPFAKSQLPIAKPLETKSFTPKTKTKASSPGQKTKSPKAALSPARLGSPIR
SPKTIPKEKKSPGRSKSPKSPKSPKIVAHVPQTPVRPETPNRTPSAMVVEKTVKETIPVM
KPTQTPPEVVKLNIEMQPKKPVVTDKTIDDSIDAVIARACAEREPDPFEFSSGSESEGDT
FTSPKRISGSECATPKASTSSNNFTKSLATPLPLSSGTSSSDNSWTMDASIDEVVRKAKL
GAPSNMPPTFPYISSPSISPPTPEPLHKGYEEKAKLPSSVDVKKKLKKELKTKLKKKEKQ
RDRERERERNKERSKEKDKMREREKEKEAGKELKYPWRELMKDEDSDPYKFKIKEFEDID
AAKVRLKDGIVRREREKHKDKKKDRERSKREKDKRERERLKEKNREDKIKAPPTQLVLPP
KEMALPLFSPSAVRVPAMLPAFSPMLPEKLFEEKEKPKEKERKKDKKEKKKKKEKEKEKE
KKEREREKERREREKREKEKEKHKHEKIKVEPVIPAPSPVIPRLTLRVGAGQDKIVISKV
VPAPEAKPAPSLNRPKTPPPAPVPIPVRVSPTPLQPPLLTQAAVCPALMPSPAPALSGIG
SAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIM
AAPPEEMQWFCPKCANKIKKDKKHKKRKHRAH
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgtgcgagagttactctaggtcgttgttgagggtctcggtggcgcagatctgccaggcg
ctgggctgggactcggtgcagctcagcgcctgccacctcctcaccgacgtcctgcagcgc
tatctgcagcagctgggccggggctgccatcggtactctgaactctatggccgaacagac
cccattttggatgatgttggtgaagccttccaacttatgggagttaatctgcatgaacta
gaagactatattcataatattgaacctgtcactttcccacatcaaattccttcatttcct
gttagcaagaacaatgtccttcagtttcctcagcccggaagtaaagatgcagaggaaaga
aaagactacattccggattaccttccccccatcgtgtcttctcaagaagaggaggaagag
gaacaggtgcccactgatgggggcacctcagcagaagccatgcaggtgcccttggaagaa
gatgatgagatggaggaggaggaagtcatcaatgatgagaacttcttgggtaagaggcca
ctggacagtcctgaagtggaagaaatgccctccatgaagcgcccacgactcctgagcact
aaaggggactccctagatgttgtgttgttagaagcacgagaacccctcagctctataaac
ccacagaagaccccaccagtgctctctcctgtgcgtgtccaggacagggctgatctggcc
cctccatcaccacagcctcccatgctggctccatttgcaaagtcacaactaccaattgca
aagccgttagaaacaaagtcgtttacaccaaaaacaaagactaaagctagctctccaggt
cagaaaactaagtcacccaaggctgccctatcaccagcaaggcttggaagtcctattcgg
tcaccaaaaaccatcccaaaagaaaagaagtcacctggacgctccaagagccccaagagt
cctaagagccccaagattgtagctcatgttccccaaacccctgtcagacctgaaacacca
aataggaccccttcagccatggtggttgaaaaaactgttaaagagaccatcccagtgatg
aaaccaacacagactcccccagaagttgtgaaactgaacattgaaatgcagccgaaaaag
cctgtggtgacagacaaaaccatcgatgactccatcgatgctgtgatcgcacgtgcctgt
gcagagcgggagccagaccctttcgagttttcttccggatcggaatcggaaggagacact
tttacaagtcctaagaggatttcaggctcagagtgcgccactccaaaagcctccacttcc
tccaataacttcaccaagtccctggccactcctctgcctctctccagcggaacctcaagt
tcagataactcgtggacaatggatgcctctattgatgaggtggtacggaaggcaaagctg
ggagccccttccaacatgcctcccaccttcccatatatctcttctccctcaatttctcct
cccactcctgagcctctacacaaggggtatgaggagaaagccaagctgccttcgtctgtg
gatgtaaagaaaaagttgaaaaaagaactgaagactaagttgaaaaagaaagaaaagcag
cgagacagagagagggagagagagagaaacaaagaaagaagcaaagagaaagataaaatg
agagagagggagaaggagaaggaggctggaaaggaacttaagtacccgtggagggagctg
atgaaagacgaagattctgatccctataagtttaaaatcaaagaatttgaagacattgat
gctgcgaaagtgcgattgaaagatgggatcgtgaggagagagcgagagaaacataaggac
aagaagaaagatcgagaaagaagcaagcgggagaaagataagcgagaaagggaaaggctt
aaagaaaaaaacagagaagacaagataaaggcccctccaacacagctggtgttgccccca
aaagaaatggcactgcctttgttcagcccttcagcagtgagggtcccggccatgctgccg
gccttctcaccaatgctcccagaaaaactgtttgaggaaaaagagaagcccaaggagaaa
gaaaggaaaaaggacaaaaaggagaagaagaagaagaaagagaaggagaaagaaaaggag
aagaaagagagggagagggagaaggagagaagggagagagagaagagagagaaggagaag
gagaagcacaaacatgagaagataaaagtggagcctgtcatccctgccccaagtccagtt
atccccaggttgactctgcgagttggcgctggccaggacaagattgttatcagcaaggtg
gtaccagccccggaggctaagcccgctccttctctgaacagacccaaaaccccacctcca
gccccagtccctattcctgtgcgagtgagccctactcccctgcagccaccactcctcacc
caggctgcagtgtgcccagccctgatgccatccccagctcccgccctctctggaataggg
agtgccaaagcccccgtgaggagcgtcgtgactgagacggtcagcacttatgtgatccgt
gatgagtggggcaatcagatctggatctgtccagggtgcaacaagcctgatgacgggagc
ccgatgattggctgtgacgactgtgacgattggtaccactggccctgtgtgggaatcatg
gctgctcctccagaagagatgcagtggttctgcccgaagtgtgccaacaagataaagaaa
gacaagaagcacaagaagaggaagcaccgtgcgcactga

DBGET integrated database retrieval system