KEGG   Mus musculus (mouse): 20941
Entry
20941             CDS       T01002                                 

Gene name
Svs4, S, SVS-IV, Sv, Svp-2, Svp-4, Svp2, Svp4
Definition
(RefSeq) seminal vesicle secretory protein 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Svs_4_5_6 Lectin_N
Other DBs
NCBI-GeneID: 20941
NCBI-ProteinID: NP_033326
MGI: 98450
Ensembl: ENSMUSG00000016998
Vega: OTTMUSG00000001083
UniProt: P18419
Position
2 H3; 2 85.01 cM
AA seq 113 aa
MNSTSLFLFSLLLLLVTGAIGKKTKEKFLQSEETVRESFSMGSRGHMSRSSEPEVFVRPQ
DSIGDEASEEMSSSSSSRRRSKIISSSSDGSNMEGESSYSKRKKSRFSQDALE
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaattctaccagtttgttcctcttttctctgcttctccttctggtgacaggagccatt
gggaagaaaactaaggaaaaattcttgcagtcggaagaaactgtcagagagagcttctcg
atgggaagcagaggccatatgtcaagaagttctgagccagaggtatttgttaggccacag
gactccatcggtgacgaagcttctgaggaaatgagtagtagtagtagtagtagaagaaga
agtaagattatctctagcagttctgatggttctaatatggaaggtgagagttcatattca
aagagaaagaagagccggttttctcaagatgcactcgagtga

DBGET integrated database retrieval system