KEGG   Mus musculus (mouse): 209446
Entry
209446            CDS       T01002                                 

Gene name
Tfe3, F830016E06Rik, Tcfe3, Tfe-3, bHLHe3, bHLHe33, mTFE3
Definition
(RefSeq) transcription factor E3
  KO
K09105  transcription factor E3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu05202  Transcriptional misregulation in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    209446 (Tfe3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    209446 (Tfe3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    209446 (Tfe3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    209446 (Tfe3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    209446 (Tfe3)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 209446
NCBI-ProteinID: NP_766060
MGI: 98511
Ensembl: ENSMUSG00000000134
Vega: OTTMUSG00000017822
UniProt: Q64092 A2AEW1 Q8K420
Position
X A1.1; X 3.5 cM
AA seq 572 aa
MSHAAEPARDAVEASAEGPRAVFLLLEERRPAESAQLLSLNSLLPESGIVADIELENILD
PDSFYELKSQPLSLRSSLPISLQATPTTPATLSASSSAGGSRTPAMSSSSSRVLLRQQLM
RAQAQEQERRERREQAAAAPFPSPAPASPAISVIGVSAGGHTLSRPPPAQVPREVLKVQT
HLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPSSAQPLPAPETAHATGPTG
SAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVSGN
LLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRFN
INDRIKELGTLIPKSNDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANR
SLQLRIQELELQAQIHGLPVPPNPGLLSLTTSSVSDSLKPEQLDIEEEGRPSTTFHVSGG
PAQNAPPQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEGMVGGLSGGALSP
LRAASDPLLSSVSPAVSKASSRRSSFSMEEES
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtctcatgcagccgagccagctcgggacgccgtagaggccagcgcggagggccctcga
gccgtgttcctgctattggaagagcgcaggccagctgagtcggcccagctgctcagcctg
aattctttgcttccggaatccgggattgttgctgatatcgagttagaaaacatcctcgat
cctgacagcttctacgagctcaaaagccaacccctatccctccgctccagcctcccaata
tcactgcaggccacaccgaccaccccagctacactctctgcgtcgtcttctgcagggggc
tcccggacccctgccatgtcatcttcttcatcacgggtcttgctgcgtcagcagcttatg
agggcccaggctcaggaacaggagaggcgtgagcggcgggaacaggcagcggccgctccc
ttccccagccctgcgcccgcctcaccagccatctctgtgattggcgtgtctgctggtggc
cacacactgagtcgtccacctcctgctcaggtgcccagggaggtactcaaggttcagacc
cacctcgagaaccctacacgctaccacctgcagcaagctcgccggcagcaggtcaaacag
tacttgtctaccacacttgggcccaagctggcttcccaggctctcaccccaccaccaggg
ccttccagtgcccagccacttcctgcccctgaaactgctcatgccaccggtcctacaggc
agtgctcctaacagccccatggcgctgctcaccattgggtccagctcagaaaaggagatt
gatgatgtcattgatgagatcatcagcctggagtccagttacaacgatgagatgctcagc
tatcttccaggaggcactgcagggctgcagctccccagcacgctgccggtgtctggaaat
ctacttgatgtgtacagcagtcagggagtggctaccccagctatcaccgtcagcaattcc
tgtccagctgagctgcctaacatcaaacgcgagatctccgaaaccgaggcaaaggccctt
ttgaaggagcgacagaagaaagacaatcacaacctaattgaacgacgcaggcgattcaac
attaacgataggatcaaagagctgggcaccctcatccccaagtccaatgatccggagatg
cgctggaacaagggcaccatcctgaaggcatctgtggattacatccgcaaattacagaag
gaacagcaacgctccaaagacctggagagccggcagcggtccctggaacaagccaaccga
agcctgcagctccggattcaggagctagaactgcaggcccagatccatggtctgccagtc
cctcccaacccaggactgctctccctaaccacgagttcggtctctgacagcctcaagcca
gaacagctggacattgaggaggagggcaggcctagcacaacgttccatgtatcgggagga
cctgcccagaacgctcctccacaacagcctccagcaccaccttcggatgcccttctggac
ctacactttcccagcgaccacttgggagacctgggggaccccttccacctagggctagag
gacattctgatggaggaggaggggatggtgggaggactgtcagggggtgccctgtcccca
ctgcgggctgcttctgaccccctgctttcttcagtatccccggctgtttccaaggccagc
agccgccgtagcagcttcagcatggaagaggagtcctga

DBGET integrated database retrieval system