KEGG   Mus musculus (mouse): 209512
Entry
209512            CDS       T01002                                 

Gene name
Taar2, Gm224, Gm225, Gpr, Gpr58, Tarr2
Definition
(RefSeq) trace amine-associated receptor 2
  KO
K05051  trace amine associated receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    209512 (Taar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    209512 (Taar2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    209512 (Taar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 209512
NCBI-ProteinID: NP_001007267
MGI: 2685071
Ensembl: ENSMUSG00000059763
Vega: OTTMUSG00000019217
UniProt: Q5QD17
Position
10; 10 A4
AA seq 339 aa
MASFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMACAIFITIFGNLAMIISISYFK
QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF
HLCSVAVDRFYAICHPLHYCTKMTIPVVRRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD
ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN
QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAVLFDALTWFGYFNSTCNP
LIYGFFYPWFRRALKYILLGKIFSSHFHNTNLFTQKETE
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcatcttttgaagcccagcaggaaacctttgattgttcagagtacggaaatggatct
tgcccagagaatgaaagatctctcggcgtccgagctgccatgtactcgttgatggcctgc
gccatattcatcacgatctttggcaacctggccatgatcatttccatttcctacttcaaa
cagcttcacacaccgaccaacctcctcattctctccatggccgtcaccgacttccttctc
ggattcaccatcatgccatatagtatggtcaggtcagtggaaaactgctggtatttcgga
cttacgttttgcaagatccattatagcttcgacctgatgcttagcataacgtccattttc
cacctttgctcggtggccgtcgatagattttatgccatctgtcaccctttgcattattgc
accaaaatgactatcccggtcgttaggcggctgctgctcgtctgctggtcagtccccggg
gcgtttgcctttggggtggtcttctccgaggcttacgctgatggaattgaaggctatgac
attttggttgcatgttccagttcctgcccagtcatgttcaacaagctatgggggaccacc
ttgtttgtggcaggctttttcactcctagctcgatgatggtggggatttacggcaaaatt
ttcgctgtatccaaaaaacacgctcgcgtaattgacaacttgccagaaaatcaaaacaat
caaatgaggaaggacaaaaaagcagccaaaactttagggatagtgatgggtgttttctta
ttgtgttggtttccatgtttcttcaccatcctgttagatccgtttctgaatttctctacg
cctgcagttctgtttgatgccttaacatggttcggttattttaattccacatgtaatccc
ttaatttatggtttcttctacccttggtttcgcagagcactcaagtacattttactgggt
aaaattttcagctcgcatttccataatactaatttgtttactcaaaaagaaacagaatag

DBGET integrated database retrieval system