KEGG   Mus musculus (mouse): 209645
Entry
209645            CDS       T01002                                 

Gene name
Bend7, 1110017O21Rik, E130319B15Rik
Definition
(RefSeq) BEN domain containing 7
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BEN LCIB_C_CA
Other DBs
NCBI-GeneID: 209645
NCBI-ProteinID: NP_848778
MGI: 2443100
Ensembl: ENSMUSG00000048186
Vega: OTTMUSG00000010737
UniProt: Q8BSV3 Q0VE44
Position
2; 2 A1
AA seq 434 aa
MEFSERKRSRKSQSFKLVSRDYHHEVYKISEFSNDVNGETKETQPIYLGDESMEIKKQIT
GMRRLLNDSTGRIYQRVGKEGEKLKQEPQVVDLVWPQRSNSSTEASQGLHSNSRGAWNEL
PTQSGQFSGQSGPRSRTFQTQPHISASSNGELPGVNSIVGSNCCTCNCQSTLQAILQELK
TMRKLMQFQAVGTQNRQQPPISLMCSQRTAVSRKRNKKKKVLPKTVQPVTAVEPKPSPLE
TEKKPAASATRPPGLQAAERTSTEENHVLGFGIVLESPSSDPEVQLAEGFDVFMPKSQLD
SILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGFNDNRKGLDQNIVGAIKVFTE
NYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSAEVADGDERLDRISLPPTGHTFVI
KRETPEDPEPGSVA
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggagttctcggagaggaaaagaagcaggaaatcccagagcttcaaactggtgagccga
gattatcaccatgaggtgtataaaatctcagaattcagcaatgatgttaatggggagacc
aaagagacacaacccatttacttaggagacgaaagcatggaaattaaaaaacaaattacg
gggatgagaagattactgaatgacagcactggaaggatatatcagcgtgtcggcaaagaa
ggagaaaaattaaaacaagagccgcaggttgtggatttagtctggcctcagcggtccaac
tcttccaccgaggcctcacagggcctccactctaattcacgtggggcgtggaatgaacta
ccaacccaaagcgggcagttctcagggcagtctggtccacgctccagaaccttccagact
cagccccacatctctgcaagttccaatggagaacttccaggggtgaattcaatagtcgga
tccaactgctgtacttgtaactgccagtcaaccttgcaggccattctccaagagctcaag
accatgaggaaattaatgcagtttcaagcagttggaactcaaaacagacaacaaccccca
atttcccttatgtgctcccagcgaaccgccgtctcacgcaagagaaataaaaagaaaaaa
gtgcttccgaagactgtgcaacctgtgacggctgtggaaccaaagcccagtcccttggaa
actgagaagaagccagcagcctcggccacaaggccaccaggtctccaagctgcagagcgc
acctccaccgaggagaaccacgtcctgggatttggcattgttctggaatcgccgtcctca
gatccagaagtgcaacttgctgaaggcttcgatgtgtttatgcccaaatctcagctggac
tctatactgtcaaactacactcgctcaggaagccttctgtttagaaaactggtgtgtgca
ttttttgacgacaagactttggctaactccttacccaacggaaagcggaaaagagggttc
aatgacaaccggaaaggactagaccaaaacattgtgggtgcaataaaagtctttacagaa
aattactgtactgcgaatcatgtggataaacttcctggccccagagactgggtgcagatt
ctgcaggatcagattaaactggccagaagaaggttgaaacgaggctcagcagaggtagct
gacggtgatgaaagactggaccgcatctctctacccccaacaggtcatacatttgtcatc
aagagagagaccccagaggacccagaaccaggttccgtggcctag

DBGET integrated database retrieval system