KEGG   Mus musculus (mouse): 20969
Entry
20969             CDS       T01002                                 

Gene name
Sdc1, AA408134, AA409076, CD138, Sstn, Synd, Synd1, syn-1
Definition
(RefSeq) syndecan 1
  KO
K06257  syndecan 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu05144  Malaria
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    20969 (Sdc1)
   04514 Cell adhesion molecules
    20969 (Sdc1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    20969 (Sdc1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    20969 (Sdc1)
  09174 Infectious disease: parasitic
   05144 Malaria
    20969 (Sdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20969 (Sdc1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    20969 (Sdc1)
   00535 Proteoglycans [BR:mmu00535]
    20969 (Sdc1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    20969 (Sdc1)
CD molecules [BR:mmu04090]
 Proteins
  20969 (Sdc1)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   20969 (Sdc1)
SSDB
Motif
Pfam: Syndecan Glycophorin_A Romo1
Other DBs
NCBI-GeneID: 20969
NCBI-ProteinID: NP_035649
MGI: 1349162
Ensembl: ENSMUSG00000020592
Vega: OTTMUSG00000033390
UniProt: P18828 Q3V1F2
Position
12 A1.1; 12 3.94 cM
AA seq 311 aa
MRRAALWLWLCALALRLQPALPQIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQT
PSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEK
EVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPR
VEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGA
TGASQSLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMKKKDEGSYSLEEPKQANGGAY
QKPTKQEEFYA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagacgcgcggcgctctggctctggctctgcgcgctggcgctgcgcctgcagcctgcc
ctcccgcaaattgtggctgtaaatgttcctcctgaagatcaggatggctctggggatgac
tctgacaacttctctggctctggcacaggtgctttgccagatactttgtcacggcagaca
ccttccacttggaaggacgtgtggctgttgacagccacgcccacagctccagagcccacc
agcagcaacaccgagactgcttttacctctgtcctgccagccggagagaagcccgaggag
ggagagcctgtgctccatgtagaagcagagcctggcttcactgctcgggacaaggaaaag
gaggtcaccaccaggcccagggagaccgtgcagctccccatcacccaacgggcctcaaca
gtcagagtcaccacagcccaggcagctgtcacatctcatccgcacgggggcatgcaacct
ggcctccatgagacctcggctcccacagcacctggtcaacctgaccatcagcctccacgt
gtggagggtggcggcacttctgtcatcaaagaggttgtcgaggatggaactgccaatcag
cttcccgcaggagagggctctggagaacaagacttcacctttgaaacatctggggagaac
acagctgtggctgccgtagagcccggcctgcggaatcagcccccggtggacgaaggagcc
acaggtgcttctcagagccttttggacaggaaggaagtgctgggaggtgtcattgccgga
ggcctagtgggcctcatctttgctgtgtgcctggtggctttcatgctgtaccggatgaag
aagaaggacgaaggcagctactccttggaggagcccaaacaagccaatggcggtgcctac
cagaaacccaccaagcaggaggagttctacgcctga

DBGET integrated database retrieval system