KEGG   Mus musculus (mouse): 20970Help
Entry
20970             CDS       T01002                                 

Gene name
Sdc3, Synd3, mKIAA0468, syn-3
Definition
(RefSeq) syndecan 3
  KO
K16337  syndecan 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    20970 (Sdc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    20970 (Sdc3)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   20970 (Sdc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan
Motif
Other DBs
NCBI-GeneID: 20970
NCBI-ProteinID: NP_035650
MGI: 1349163
Ensembl: ENSMUSG00000025743
Vega: OTTMUSG00000009594
UniProt: Q64519
Position
4 D2.2; 4 63.63 cM
AA seq 442 aa AA seqDB search
MKPGPPRRGTAQGQRVDTATHAPGARGLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLE
GSGDDDSFPDDELDDLYSGSGSGYFEQESGLETAMRFIPDMALAAPTAPAMLPTTVIQPV
DTPFEELLSEHPSPEPVTSPPLVTEVTEVVEESSQKATTISTTTSTTAATTTGAPTMATA
PATAATTAPSTPEAPPATATVADVRTTGIQGMLPLPLTTAATAKITTPAAPSPPTTVATL
DTEAPTPRLVNTATSRPRALPRPVTTQEPDVAERSTLPLGTTAPGPTEMAQTPTPESLLT
TIQDEPEVPVSGGPSGDFELQEETTQPDTANEVVAVEGAAAKPSPPLGTLPKGARPGPGL
HDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT
LEEPKQASVTYQKPDKQEEFYA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgggccgccgcgccgcgggaccgcacaggggcagcgcgtggacaccgccacc
catgcgcccggggcccgcgggctgttgctgccaccgctgctgctgctgctgctggccggc
cgcgccgcgggggctcaacgctggcgcaatgagaacttcgagaggccggtggatcttgag
ggctcaggggatgacgactcgtttcctgatgatgaactagacgacctctactcggggtca
ggctctggctacttcgagcaggagtccggccttgagacggccatgcggttcatccctgat
atggccctggctgcgcccactgcacctgccatgctacccacaaccgttatccagcccgtg
gacaccccatttgaggaactcctttctgagcaccccagccctgaaccagtcaccagtccc
ccgctggtgacagaggtgacagaggtcgtagaagagtccagccagaaagctaccaccatc
tctaccaccacatctaccaccgcggccaccaccacaggggccccaactatggccacagca
cctgccacagcagccaccactgcccctagcactcccgaggcgccccctgccacggctacc
gtggctgacgtaaggaccaccggcatacaggggatgctgcctcttcccctgaccacagct
gccacagccaagatcactaccccagcagcaccctcaccacccactactgtggctaccttg
gacacagaggccccgacacctaggctggtcaacacagctacctcgaggccacgagccctt
cctcggccagtcaccacccaggagcctgatgttgctgagaggagtaccctgccgttgggg
accacggctcctggacccacggagatggctcagaccccaactccagagtcccttctgacc
accatccaggatgagccagaggtgccagtaagtggggggcccagcggggactttgagctt
caagaagagaccacgcagccggacacggccaatgaggtggtggctgtggaaggagccgcg
gccaagccgtcacctccactggggacactgcccaagggtgcccgcccaggccctggcctc
cacgacaatgccatcgattcgggcagctcggccgcccagctccctcagaagagcatactg
gagcggaaggaggtgctcgtagccgtgatcgtgggtggggtggtgggcgccctcttcgct
gccttcctggtcacgctgctcatctaccgcatgaagaagaaggacgaaggcagctacacc
ttggaagaacccaagcaggcaagcgtcacgtaccagaaacctgacaagcaggaggagttc
tacgcttag

DBGET integrated database retrieval system