KEGG   Mus musculus (mouse): 20973Help
Entry
20973             CDS       T01002                                 

Gene name
Syngr2, Clast2, cellugyrin
Definition
(RefSeq) synaptogyrin 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL CD20
Motif
Other DBs
NCBI-GeneID: 20973
NCBI-ProteinID: NP_033330
MGI: 1328324
Ensembl: ENSMUSG00000048277
Vega: OTTMUSG00000003678
UniProt: O55101
Position
11; 11 E2
AA seq 224 aa AA seqDB search
MESGAYGAANAGGSFDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCV
FNQNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWF
VGFCFLTNQWAATKPQDVRVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQN
YVDPTPDPNTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagagcggggcctatggcgcggccaacgcgggcggctccttcgacctgcggcgcttc
ctgtctcagcctcaggtggtgacgcgcctcgtgagcatggtcttggccttgatcgtgttc
tcctgcatcttcggcgagggctacaccaacattcacacatctgatcaactatactgtgtg
ttcaaccagaatgaggatgcctgccgctacggcagcgccatcggggtgctggccttcctg
gcctcagccttcttccttgtggtcgatgccttcttctcccagataagcaatgccactgac
cgaaagtacctggtcattggcgacctgctcttctcagctctctggaccttcctgtggttt
gttggtttctgcttcctgaccaaccagtgggcagccaccaaacctcaagatgtccgggtg
ggtgcggactcagctcgggcagccatcaccttcagcttcttctccatcttttcctggggt
gtgctggcttccctggcctaccagcgctacaaggctggagtggatgccttcattcagaac
tacgtggatcccaccccggatcccaacacagcctatgcctcctaccctagtgcctccgtg
gaaaactaccagcagccgcccttcacccagaatgtggagactactgagggctaccagcct
ccccctgtgtactga

DBGET integrated database retrieval system