KEGG   Mus musculus (house mouse): 209737
Entry
209737            CDS       T01002                                 
Symbol
Kif15, 3110023M17Rik, 3930402I10Rik, D330038N01, HKLP2, Knsl7, b2b1117.1Clo, b2b1117.1aClo
Name
(RefSeq) kinesin family member 15
  KO
K10400  kinesin family member 15
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    209737 (Kif15)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     209737 (Kif15)
SSDB
Motif
Pfam: Kinesin Microtub_bd HMMR_C Snurportin1 Acetyltransf_9 Eplus_motif
Other DBs
NCBI-GeneID: 209737
NCBI-ProteinID: NP_034750
MGI: 1098258
Ensembl: ENSMUSG00000036768
UniProt: Q6P9L6
Position
9:122780146..122847798
AA seq 1387 aa
MAPGCKSELRNVTNSHSNQPSNEGDAIKVFVRIRPAEEGARSADGEQSFCLSVLSQTTLR
LHSNPDPKTFVFDYVAGMDTTQESVFSTVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMM
GPSDSDNFSHNLRGIIPRSFEYLFSLIDREKEKAGAGKSFLCKCSFIEVYNEQIYDLLDS
ASVGLYLREHIKKGVFVVGAVEQAVTSAAETYQVLSRGWRNRRVASTSMNRESSRSHAVF
TITIESMEKSSETVNIRTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVIT
ALVDVGNGKQRHICYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGETLSTLNFAQRA
KLIKNKAVVNEDTQGNVSQLQAEVKRLKEQLSQFTSGQITPESLLARDKEKTNYIEYFLE
AMLFFKKSEQEKKSLIEKITQLEDLTLKKEKFIQSNKMIVKFREDQIMRLERLHKEGRGS
FLPEEQDRLLSELRDEVQTLREHVEHHPRLAKYAMENHSLREENRRLKLLAPVKRAHEID
AQSIARLEKAFAEVSSTETNDKGLQGFSPKALKESSFFTNTEKLKAQLLQIQTELNNSKQ
EYEEFKELTRKKQLELESELQSLQKANLNLENLLEATKVCKRQEVSQLNKLHAETLKIIT
TPTKAYQLCSRLVPKSSPEVGSFGFLCTESSSRLDNDILNEPVPPEMSEQALEAVSEELR
TVQEQLSVLQVKLDEEERKNLKLQQNVDKLEHHSTQMQELFSSERSDWTKQQQEHVTQLS
DLEKQLQDAQTKNEFLKCEVHDLRIVLNSADKELSLVKLEYSTFKENHEKELSQLSERHV
QVQLQLDNARLENEKLLESQACLQDSYDNLQEVMKFEIDQLSKNLQNCKQENETLKSDLH
NLVELFEAEKERNNKLSLQFEEDKENSSKEILKVLETVRQEKQKEMAKCEKQMAKIQKLE
ESLLATENVISSLEKSRESDKELVTNLMNQIQELRISIGEKSETIATLKQELQDINCKYN
ASLADKEESKELIRRQEVDILELKETLRLRILSEDIERDMLCEDLAHATEQLNMLTEASK
KHSGLLQSAQEELTRKEALIQELQHKLNQEKEEVEQKKNEFSLKMRQLEHVMGSATEYPQ
SPKTPPHFQAHLAKLLETQEQEIEDGRASKTSLQHLVTKLNEDREVKNAEILRMKDQLCE
MENLRLESQQLREKNWLLQRQLDDVKRQQESGDQSHPDSQQLKNEHEEIIKERLAKNKLI
EEMLKMKTNLEEVQSALHSKEKACHRMSEEIERTRTLESRAFQEKEQLRSKLEEMYEERE
RTFLEMEMLKKQLEFLAEENGKLVGHQNLHQKIQYVVRLKKENIRLTEETEKLRAENLFL
KEKKKEF
NT seq 4164 nt   +upstreamnt  +downstreamnt
atggcccccggctgcaaatctgagttacggaatgtgacaaattctcattctaaccagcca
agtaatgaaggtgacgctatcaaagtttttgtgcgaattcgtcctgctgaagagggcgcc
agatcagcggatggagagcagagcttttgcttatctgtgctctcccagaccactctccgg
ctacactccaacccagaccccaagacttttgtatttgattatgttgcaggcatggacacc
actcaggagtctgtattctcaacagtggctaaaagcattgtggaatcatgcatgagcggt
tataatgggaccatctttgcatatgggcagactggctctgggaagacatttactatgatg
ggaccatcagactctgataatttttctcataatctgagaggaataattccacgaagtttt
gaatatttgttttccttaattgatcgtgaaaaagaaaaggctggagctgggaagagtttc
ctttgtaagtgctcctttattgaggtctacaatgagcagatatatgacctcctggactcg
gcgtcagtcggactgtatttgagagagcacataaagaagggagtctttgtggtcggtgca
gtggagcaggcggtgacctcagctgccgagacctaccaggtcttatctagaggctggagg
aacagacgtgtagcatcaacatctatgaacagagagtcttctagatcccatgcagtcttt
accatcacaatagaatcaatggagaagagcagcgagaccgtgaacatccggacctcctta
ctcaacctggtggacttagcaggatctgagaggcaaaaagacacccatgcagaagggatg
aggctgaaggaggcaggtaacataaaccgatcgctgagctgcctgggccaagtcatcact
gcccttgttgatgtgggtaatggaaaacagaggcatatctgctacagagactccaaactt
accttcttacttcgggactcccttggtggcaatgccaaaacagctataattgcaaatgtt
catccaggatccaggtgttttggagaaacactgtcaacacttaattttgctcaaagagcc
aagctgattaaaaacaaggctgtggtaaatgaagacacccaaggaaatgtcagccaactg
caagctgaagtgaaaaggctcaaagaacaactgtctcaatttacttctgggcagataaca
ccagaaagcttattggccagagataaagagaagactaattacatagaatatttcctggaa
gcaatgttattctttaagaaatctgaacaggaaaaaaagtctctaatagaaaaaattacc
caactagaagatctcaccctcaaaaaggaaaaatttattcagtctaataaaatgattgtg
aagttccgggaggaccaaatcatgcgtctagagaggctccataaggagggtcgaggaagc
ttcctgccggaggagcaggatcgcctgctgtcagagctgcgggatgaggtccagacgctt
cgagagcacgtggagcaccatcctagacttgcaaagtatgctatggaaaaccattccctc
agggaagagaatagaagactgaagttactagcacccgtaaaaagagcccatgaaatcgat
gcccagtctattgcaagactagaaaaagctttcgctgaagtgtctagcacagagacaaat
gacaaaggtctgcaaggattttctcccaaagcactaaaagaatcaagtttcttcacaaac
accgagaagttaaaagcacaactcctgcaaattcagacagaactgaataattcaaagcaa
gaatatgaagaattcaaagaattaactcggaaaaagcagctagagctagaatcagagctt
cagtctttgcaaaaagcaaacctcaatcttgaaaaccttttggaggcaacaaaagtctgc
aaacgccaggaagtttcccagctgaataaactacatgctgaaacactcaagataattacc
actccaaccaaggcttatcaactttgttctagactagtaccaaagtcaagccctgaggtg
gggagctttggctttctgtgcacagagagctctagcaggctggataatgatatattaaat
gaaccagtgccacctgagatgagtgagcaagctctggaggccgtttcagaggagcttcga
actgtgcaggaacaactgagtgttcttcaagtgaagctggatgaagaagaacgtaaaaac
ctgaaacttcaacagaatgttgacaagctagaacaccattctacacaaatgcaggagctt
ttctcatcagaaagaagcgattggaccaaacaacagcaagagcacgtcacacagctgagt
gacctggaaaagcagctgcaggatgctcagactaagaatgagtttttgaaatgtgaggtg
catgacctgcgaattgttcttaattctgctgacaaagaactttctttggtgaaactggag
tatagcacattcaaagagaatcacgagaaagaactaagccagctttctgaaagacatgtg
caggttcagcttcagctggacaacgccagattagaaaatgaaaaacttcttgagagccaa
gcctgtctacaggattcctacgataacttacaagaagtaatgaaatttgaaatcgaccaa
ctttcaaaaaatctccaaaactgcaaacaagaaaatgaaactttaaagtctgatctgcat
aatttggtggagctttttgaagcagaaaaagaacgcaacaacaaattgtcattacaattt
gaagaagataaagaaaacagctctaaagaaatcttaaaggttcttgaaactgtacgtcag
gaaaaacagaaagagatggccaagtgtgaaaagcagatggcaaaaatacagaaactagaa
gaaagcttgcttgctactgaaaatgttatcagctctctggaaaagtctagagagtctgac
aaggaacttgtcaccaacctcatgaaccaaatccaggagttaagaatatcaattggtgaa
aaatcagaaaccatagccaccctgaaacaagaacttcaagacataaattgcaaatacaat
gcttcattggctgacaaagaagagagcaaggaattgatcaggagacaggaagtggatatc
ctggaactgaaagaaactcttagactgagaatcctctcagaggacatcgagagggacatg
ctctgtgaagatctggcccatgccactgagcagctgaacatgctcacggaggcttccaag
aagcactctggactgctgcagtctgctcaagaggagctgaccaggaaggaggcgctgatc
caggaactgcaacacaagttaaaccaggagaaggaggaagtggagcagaagaagaatgag
ttcagcttgaagatgaggcagctggagcacgtgatgggctctgctaccgagtatccacag
agtcccaaaacaccaccccattttcaagctcatttggcaaaactcttggaaacacaagaa
caagagatagaagatggaagagcctctaagacttctttgcaacaccttgtaacaaagcta
aatgaagatagagaagtcaaaaatgctgaaattctcagaatgaaggatcaattgtgtgaa
atggaaaatctacgcctggagtctcagcaattaagagagaaaaactggctcctgcaacgt
cagctggatgatgtgaaaaggcagcaggagagtggcgatcagagtcatccagacagtcaa
cagctgaagaatgaacatgaagagattatcaaagaaagacttgctaagaataaacttatt
gaagagatgctgaaaatgaaaacaaatctagaagaagtccagagtgcacttcacagcaag
gagaaggcctgccacagaatgagtgaggaaattgagcgaaccagaactttggagtctaga
gcatttcaggaaaaggagcaactgcggtcaaagttggaagaaatgtatgaagaaagagag
agaactttcctggaaatggaaatgctgaaaaagcaactagaatttcttgctgaggaaaat
ggaaaattggtaggtcatcaaaacctacatcagaagattcaatatgtagtacgactgaag
aaggaaaatatcaggcttactgaggagacagaaaaattgcgtgctgaaaatctatttttg
aaagaaaaaaagaaggaattctaa

DBGET integrated database retrieval system