KEGG   Mus musculus (house mouse): 209743
Entry
209743            CDS       T01002                                 
Symbol
Minar1, DD1, Kiaa1024
Name
(RefSeq) membrane integral NOTCH2 associated receptor 1
  KO
K24829  major intrinsically disordered Notch2-binding receptor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    209743 (Minar1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Others
   209743 (Minar1)
SSDB
Motif
Pfam: MINAR1_C
Other DBs
NCBI-GeneID: 209743
NCBI-ProteinID: NP_705729
MGI: 2667167
Ensembl: ENSMUSG00000039313
Vega: OTTMUSG00000045620
UniProt: Q8K3V7
Position
9:complement(89469261..89505940)
AA seq 917 aa
MEANQEASLFLVKILEELDSKQNTVSYQDLCKSLCAQFDLSQLAKLRSVLFYTACLDPNF
PATLFKDKMKCSVNNQQSKKIMVAADIVTIFNLIQMNGGTAKEKLPMSCHKVRKKEASFE
SCRSDTEVCSPTVCEPLNCELSERPFSRGYPTRQSSKCRKMDCKECPQFVPASEPNFLLG
VSKEVKNRAASLDRLQALSPYSVASPQPCEMQRTYFPMNIENEPMSDQDSLPISQGIKET
FISSEEPFVVQSCVQKRNIFKEDFHNLMTVSPSLVGTTNKAEEGHGEPQSQKELHKPPFF
NHSFEMPYHNQYLNPVYSPIPDKRRAKHESLDDLQASTYFGPTPVMGTQDTRRCPGRSSK
QTPWPAKSWSLNTEEVPDFERSFFNRNPSEEKLRYPNSGSQTPNFSGPDRHPVYLVPKDQ
QKVLPAGYAVKPNGLKSKEISSPVDLEKHEAVKKFKDKSISCTSGQHSSDTSSVGTQTEQ
HVLDPPKCKDLCTSGQAKYGDRHAMKQSDDDSEIVSDDISDIFRFLDDMSISGSTGVIQS
SCYNSTGSLSQLHKSDCDSSPEHHLAKITNGVSSGKGDKCNRPENVHHSEEELKSSVCKL
VLRIGEIERKLESLSGVREEISQVLGKLNKLDQKIQQPEKVNVQIDLNSLTSEAPSDDSA
SPRVFRAHSGSHGPKLENSPDWCCSDASGSNSESLRVKALKKSLFTRPSSRSLTEENSAT
ESKIASISNSPRDWRTITYTNRMSLNEEEIKDAGPANNKDWHRKSKEADRQYDIPPQHRL
PKQPKDGFLVEQVFSPHPYPTSLKGHMKSNPLYTDMRLTELAEVKRGQPSWTIEEYARNS
GDKGKLTALDLQTQESLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCKIAALITAA
ACTVILVIVVPICTMKS
NT seq 2754 nt   +upstreamnt  +downstreamnt
atggaggccaatcaggaagcttccctctttttggtgaagatcttagaagaactggacagt
aaacaaaatactgtttcctatcaagacctgtgcaagtcactctgtgcccagtttgatctg
tctcagcttgccaaactgagaagtgtgcttttctatacagcatgcctcgatcccaacttt
ccagcaactttattcaaagacaagatgaaatgctctgtaaataatcagcagtcaaagaaa
atcatggtggcagcagatatcgtaacaatcttcaacctgatccagatgaatgggggcact
gccaaggagaagctgcccatgagttgccacaaggtgcgcaagaaggaagcatcctttgag
tcttgccggtccgacaccgaggtgtgcagcccgacagtttgtgagcctctgaactgtgag
ctgagtgagagacccttcagccgaggctaccccaccaggcagtcatccaaatgccggaag
atggactgtaaggaatgcccacagtttgtccctgcctctgagcccaacttcctgttgggt
gttagcaaagaggtgaaaaatcgggcagcctctctggataggctgcaagccctgtccccc
tattctgtggccagccctcagccctgtgagatgcagaggacctatttccccatgaatatt
gagaacgagcccatgtcagatcaggactctctgcccatcagccaaggcatcaaagagacc
ttcatctccagtgaggaaccgtttgtggttcagtcctgtgttcagaaaaggaacatcttc
aaagaagacttccacaatctcatgactgtatcccccagtttggttggtacaactaacaaa
gcagaagagggtcatggggagccccagagtcagaaggagctccacaagccacccttcttc
aaccacagctttgagatgccttaccacaaccaatacctgaatccggtgtattcccccatc
cctgacaaaaggcgggcgaagcatgaaagcttagatgaccttcaagcctctacctatttt
ggacccactccagtgatgggaacacaagataccaggcgctgtccagggaggtccagtaaa
cagactccatggcccgccaaaagctggagcctaaacacggaggaagtgcctgatttcgaa
cgctcctttttcaatagaaatccctctgaagagaagctacgctatccaaattctggcagc
cagactcccaatttctcaggcccagacaggcatccagtttacttggtgccaaaggatcaa
cagaaggttctccctgctggctatgcagtgaaaccaaatggactcaaatcgaaagagatc
tcgtcccctgttgacctagagaagcacgaagcagtcaagaagtttaaagacaaaagcatc
agctgcaccagtgggcagcacagctcagacaccagtagtgtgggtacccagacagagcag
catgtgctggatccccccaaatgcaaagatttgtgtacttcgggtcaggccaagtacggt
gacaggcatgccatgaagcagtcggacgatgactcagaaatcgtcagcgacgacatcagt
gacattttccggtttctcgatgacatgagcatcagcggctccacaggagtgatacagtca
tcctgctacaacagcaccggctccttgtctcagcttcataagtcagactgtgatagttcg
ccagagcaccacctcgccaaaatcaccaatggggtctccagcggcaagggggacaagtgt
aaccggcctgaaaacgtccatcactccgaggaagagttgaagagtagcgtgtgcaaactg
gttctcaggattggtgagatagagcggaagctggaatcgctgtctggggtccgagaggaa
atctcccaggtccttgggaaactcaataaactggatcagaaaatacagcagccggagaaa
gtgaatgtgcagattgacctgaactccttgacgagtgaggcaccttctgatgacagcgcc
tctccgagggtcttccgtgcacacagtggctcccacggacctaagctggagaacagtcct
gactggtgctgctcagatgccagtggaagtaacagtgaaagcctgcgtgtcaaggcctta
aagaaaagcctctttaccaggccatcttccaggtccctgactgaggagaacagtgccaca
gagtctaaaattgccagcatctcgaactctcccagagactggcgaaccatcacatacacc
aaccggatgagcctcaacgaggaggagataaaagatgcaggcccagccaataacaaagat
tggcatcggaaatctaaggaggcagacaggcagtatgacatccccccacagcacagattg
cccaagcagcccaaagatggcttcctggtggagcaggtgttcagccctcatccttacccc
acctccctcaagggccacatgaagagcaaccccctgtatacagacatgcggctgactgaa
ctagctgaggtgaagcggggccagccttcttggaccatagaggaatatgctcggaactcc
ggtgacaaaggcaagctgacagctctggacctgcagacccaagaatctttaaacccaaac
aacttagagtactggatggaagatatttatactccaggctatgattcattactaaaacgg
aaagaagctgaattcagacgagccaaggtttgcaagatcgctgctcttatcactgctgct
gcatgcacggtcattcttgtcattgttgtgccaatctgcacgatgaagtcctga

DBGET integrated database retrieval system