KEGG   Mus musculus (house mouse): 209776
Entry
209776            CDS       T01002                                 
Symbol
Gpr139, GPRg1, Gm495, PGR3
Name
(RefSeq) G protein-coupled receptor 139
  KO
K08428  G protein-coupled receptor 139
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    209776 (Gpr139)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   L-Tryptophan and L-Phenylalanine
    209776 (Gpr139)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 209776
NCBI-ProteinID: NP_001019309
MGI: 2685341
Ensembl: ENSMUSG00000066197
UniProt: Q80UC8 A0A142CHG4
Position
7:complement(118739970..118783761)
AA seq 345 aa
MEHTHAHLAANSSACGLGFVPVVYYSFLLCLGLPANILTVIILSQLVARRQKSSYNYLLA
LAAADILVLFFIVFVDFLLEDFILTMQMPLIPDKIIEVLEFSSIHTSIWITVPLTVDRYI
AVCHPLKYHTVSYPARTRKVILSVYITCFLTSIPYYWWPNIWTEDYISTSMHHVLVWIHC
FTVYLVPCSIFFILNSIIVYKLRRKSNFRLRGYSTGKTTAILFTITSIFATLWAPRIIMI
LYHLYGAPIQNPWLVHIMLDVANMLALLNTAINFFLYCFISKRFRTMAAATLKALFKCQK
QPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKHGKPIKVSP
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggagcacacgcacgcccacctcgctgcgaatagctcggcttgcggcttaggcttcgtg
ccggtggtctactacagcttcttgctgtgcctcgggttaccagcaaatatcttgacagtc
attatcctctctcaactggtagccagaagacagaagtcctcctacaactatcttctggca
cttgctgctgctgacatcttggtcctctttttcattgtctttgtggatttcttgttagaa
gatttcattttgaccatgcagatgcctctgatccctgacaagatcatagaagttctagag
ttctcctccatccacacttctatttggattacggtccccttaacggttgacaggtatatc
gctgtctgtcacccactcaaataccacacagtttcctacccagccaggacccggaaagtc
attctgagtgtttacataacttgcttcctgaccagtatcccctactactggtggcctaac
atctggaccgaagactacatcagcacctccatgcatcatgtccttgtctggatccactgt
ttcaccgtgtacctggtgccctgctccatcttcttcatcttgaactccatcattgtgtac
aagcttaggagaaagagcaatttccgcctccgtggctattccacagggaagaccactgcc
atcttgtttaccattacctccatcttcgccaccctctgggccccccgcatcatcatgatt
ctctaccacctctacggagcacccatccagaacccttggctggtccacatcatgttggat
gttgccaacatgctagcccttctgaacacagccatcaacttctttctctactgcttcatc
agcaagcgcttccgtaccatggcagctgccacactcaaggccttgttcaagtgtcagaag
cagcctgtacagttctataccaaccataacttttccataacaagtagtccctggatctca
ccagcaaactcacactgcatcaagatgctggtgtaccagtatgacaaacatggaaagcct
ataaaagtatccccgtga

DBGET integrated database retrieval system