KEGG   Mus musculus (house mouse): 20980
Entry
20980             CDS       T01002                                 
Symbol
Syt2, IP4BP, R74640, mKIAA4194, sytII
Name
(RefSeq) synaptotagmin II
  KO
K19902  synaptotagmin-2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20980 (Syt2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    20980 (Syt2)
SSDB
Motif
Pfam: C2 CEP76-C2 TMEM52 MAP17 DOCK-C2 PI3K_C2 FAM176 EphA2_TM
Other DBs
NCBI-GeneID: 20980
NCBI-ProteinID: NP_033333
MGI: 99666
Ensembl: ENSMUSG00000026452
UniProt: P46097 A0A0R4J2C2
Structure
Position
1:134574272..134680887
AA seq 422 aa
MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINK
IPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDD
DDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDP
YVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDI
IGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVV
TVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGK
NK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagaaacatcttcaagaggaaccaggagccaaatgtggctccggccaccaccactgcc
acaatgccccttgcacccgtcgcacctgccgacaactctacagagagcacgggtcctggg
gagagccaagaagacatgttcgccaagctgaaggagaaattcttcaatgagatcaacaag
atccccttgcccccctgggctctgatcgccatggctgtggttgctggcctcctgctgctc
acctgttgcttctgcatctgtaagaagtgctgctgcaagaagaagaagaacaagaaggag
aagggcaaaggcatgaagaacgccatgaacatgaaggacatgaaagggggccaggatgac
gatgatgcagagacaggcctgactgaaggagaaggtgaaggcgaggaggagaaagagcca
gagaacctgggcaaattgcagttttctctggactatgatttccaggccaaccagctcacc
gtgggtgtcctgcaggctgcggaactcccagccctggacatgggtggcacatcagaccct
tatgtcaaagtcttcctcctcccagacaagaagaagaaatatgagactaaggtgcatcgg
aagacgctgaacccagccttcaatgagacattcactttcaaggtgccataccaggagtta
ggaggcaagaccctggtgatggcaatctatgactttgaccgcttctctaagcatgacatc
atcggggaggtgaaggtacccatgaacacagtggaccttggccagcccatcgaggaatgg
agagacctacaaggcggagagaaggaagagccagagaagttgggtgacatctgtacctcc
ttgcgctacgtgcccacagctgggaagctcaccgtctgtatcctggaggccaagaacctg
aagaagatggatgtagggggcctttcagacccctatgtgaagatccacctgatgcagaac
ggtaagagactcaagaagaagaagacgacagtgaagaagaagaccctgaacccctacttc
aacgagtccttcagcttcgagatcccctttgagcagatccagaaagtccaggtggtcgtc
accgtgctagactacgacaaactgggcaagaatgaagccatcggaaagatctttgtaggc
agcaacgccacaggcaccgagttgcggcactggtccgacatgctggccaaccctcggagg
cccattgcccagtggcactctcttaagcctgaggaagaagtggatgctcttctgggcaag
aacaagtag

DBGET integrated database retrieval system