KEGG   Mus musculus (mouse): 20983
Entry
20983             CDS       T01002                                 

Gene name
Syt4, SytIV
Definition
(RefSeq) synaptotagmin IV
  KO
K19904  synaptotagmin-4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20983 (Syt4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    20983 (Syt4)
SSDB
Motif
Pfam: C2
Other DBs
NCBI-GeneID: 20983
NCBI-ProteinID: NP_033334
MGI: 101759
Ensembl: ENSMUSG00000024261
UniProt: P40749
Position
18 B1; 18 17.75 cM
AA seq 425 aa
MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGV
DIYPENLSSKKKFGGDDKSEVKGKAALPNLSLHLDLEKRDLNGNFPKANPKAGSSSDLEN
VTPKLFTETEKEANSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGL
PAMDEQSMTSDPYIKMTILPEKKHRVKTRVLRKTLDPVFDETFTFYGIPYPHIQELSLHF
TVLSFDRFSRDDVIGEVLIPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWH
MLCDG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctcctatcaccaccagccgcgtggaattcgatgaaattcccacagtggtgggcatc
ttcagtgcttttggcctcgtcttcactgtctctctctttgcctggatctgctgtcagaga
agatcagccaaatccaacaagactcctccatacaagtttgtgcacgtgcttaaaggagtt
gatatctacccagaaaacctaagtagcaaaaagaagtttggaggagatgacaagagtgaa
gtgaagggtaaagccgctctgcccaacctttccctgcatcttgacctagagaagcgagac
ctcaatggcaacttccccaaagccaaccccaaagctggcagctcttctgatctggaaaat
gtcaccccaaagctctttacggagacagaaaaggaggccaattcccctgagagcttgaag
tccagcacttccctcacgtcagaggagaaacaagagaagctggggacactcttcttgtct
ctagagtacaacttcgagaagaaagcatttgtggtgaacatcaaggaagcccagggctta
ccagccatggacgagcaatccatgacctctgacccgtacatcaaaatgacaatcttacca
gagaagaagcacagagtgaagaccagagtgctcaggaagacgctggaccctgtttttgat
gaaaccttcacattctatggaatcccttatccccacatccaagagctctccttgcacttt
acagttctgagttttgacaggttttctagagatgatgtcattggagaagtcctgattcct
ctttcagggattgaattatcagatggaaaaatgttaatgactagagagatcatcaagaga
aatgctaagaagtcttctggccggggtgaacttctggtctctctctgttatcagtccact
acaaacacgctcactgtggtggtcttaaaagcgcggcacctaccgaaatctgatgtgtct
ggactttcagatccctacgtcaaagtgaacctgtaccatgccaagaagagaatctctaaa
aagaagactcacgttaagaaatgcactcccaacgcagtgttcaatgaactgtttgtcttt
gatattccttgtgagagtcttgaagaaatcagtgttgaattcttggttttggattctgaa
aggggatcccgaaatgaggtgattggacggttggtcctgggtgccacagcagaaggaagc
ggtggggggcactggaaggagatctgtgacttccccaggagacaaattgctaagtggcac
atgctctgtgatggttag

DBGET integrated database retrieval system