KEGG   Mus musculus (mouse): 20997
Entry
20997             CDS       T01002                                 

Symbol
T, Bra, D17Mit170, Low, Lr, T1, Tbxt, Tl2, Tl3, cou, me75
Name
(RefSeq) brachyury, T-box transcription factor T
  KO
K10172  brachyury protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20997 (T)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   T-box
    20997 (T)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 20997
NCBI-ProteinID: NP_033335
MGI: 98472
Ensembl: ENSMUSG00000062327
Vega: OTTMUSG00000026263
UniProt: P20293 Q78ZW9
Position
17:8653255..8661328
AA seq 436 aa
MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVTADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNDHKDVMEEPGDCQQPG
YSQWGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYPALRNHRSSPYPSPYAHRNSS
PTYADNSSACLSMLQSHDNWSSLGVPGHTSMLPVSHNASPPTGSSQYPSLWSVSNGTITP
GSQTAGVSNGLGAQFFRGSPAHYTPLTHTVSAATSSSSGSPMYEGAATVTDISDSQYDTA
QSLLIASWTPVSPPSM
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagctcgccgggcacagagagcgcagggaagagcctgcagtaccgagtggaccacctg
ctcagcgccgtggagagcgagctgcaggcgggcagcgagaagggagaccccaccgaacgc
gaactgcgagtgggcctggaggagagcgagctgtggctgcgcttcaaggagctaactaac
gagatgattgtgaccaagaacggcaggaggatgttcccggtgctgaaggtaaatgtgtca
ggcctggaccccaatgccatgtactctttcttgctggacttcgtgacggctgacaaccac
cgctggaaatatgtgaacggggagtgggtacctgggggcaaaccagagcctcaggcgccc
agctgcgtctacatccacccagactcgcccaattttggggcccactggatgaaggcgcct
gtgtctttcagcaaagtcaaactcaccaacaagctcaatggagggggacagatcatgtta
aactccttgcataagtatgaacctcggattcacatcgtgagagttgggggcccgcaacgc
atgatcaccagccactgctttcccgagacccagttcatagctgtgactgcctaccagaat
gaggagattacagcccttaaaattaaatacaacccatttgctaaagccttccttgatgcc
aaagaaagaaacgaccacaaagatgtaatggaggaaccgggggactgccagcagccgggg
tattcccaatgggggtggcttgttcctggtgctggcaccctctgcccgcctgccagctcc
caccctcagtttggaggctcgctctctctcccctccacacacggctgtgagaggtaccca
gctctaaggaaccaccggtcatcgccctaccccagcccctatgctcatcggaacagctct
ccaacctatgcggacaattcatctgcttgtctgtccatgctgcagtcccatgataactgg
tctagcctcggagtgcctggccacaccagcatgctgcctgtgagtcataacgccagccca
cctactggctctagccagtatcccagtctctggtctgtgagcaatggtaccatcacccca
ggctcccagacagctggggtgtccaacgggctgggagctcagttctttcgaggctcccct
gcacattacacaccactgacgcacacggtctcagctgccacgtcctcgtcttctggttct
ccgatgtatgaaggggctgctacagtcacagacatttctgacagccagtatgacacggcc
caaagcctcctcatagcctcgtggacacctgtgtcacccccatctatgtga

DBGET integrated database retrieval system