KEGG   Mus musculus (mouse): 210004
Entry
210004            CDS       T01002                                 

Gene name
B3gntl1, 6030413G23Rik
Definition
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4 Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 210004
NCBI-ProteinID: NP_848779
MGI: 2441705
Ensembl: ENSMUSG00000046605
Vega: OTTMUSG00000004680
UniProt: Q3U129
Position
11; 11 E2
AA seq 357 aa
MEVSENATTRGSLALVSIILPVHNAEQWLDECLMSVLQQDFEGAMELSVFNDASKDKSRA
IIEKWKVKLEDSGISVVIGGHDSPSPRGVGYSKNQAVAQSTGSYLCFLDSDDVMMPQRVR
MQYEAAGQHPTSIIGCQVRRDPPDSTERYTRWINHLTSDQLLTQVFTSHGPTVIMPTWFC
SRAWFSHVGPFDEGGQGVPEDLLFFYEHLRKGGGVFRVDHSLLLYRYHLYAATHSVLEMT
IWTHRVHFLEEQVLPHWKSFTIWNAGKQGRKLYRSLTAASRHKVVAFCDVDENKIRKGFY
CYEDSQERPKPKVPILHFQAAQSPFVICVKLDLTGGEFEDNLKSLDLQEGRDFVHFS
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggtctccgagaacgccacaacgcgcggctcgctggccctagtgtctatcatcctc
cccgtgcacaacgctgagcagtggttggatgagtgcttgatgtctgttttgcagcaagac
tttgaaggtgccatggagctctctgtttttaacgatgccagcaaggacaagtctagggcc
atcattgaaaaatggaaggtgaaactggaagattctggaatctctgtagtcatcggaggc
catgactctccttctcccagaggagttggatattctaaaaaccaagccgtcgcacagagc
acagggtcttacctttgctttttggattcagacgatgtcatgatgccgcagagagtgagg
atgcagtacgaagctgccggtcagcacccgacgagtatcataggatgccaagtgagaaga
gatcccccggactctacagagcgatatacacgttggatcaaccatttgacatctgatcag
ctgctgacacaggtgttcacctcccacggccccacggtgatcatgcctacctggttctgc
tctcgggcctggttctcccacgtgggcccatttgatgaaggaggccagggtgttccagag
gatctgctgttcttctatgagcacctcaggaagggcggtggcgtcttccgggtggaccac
agcctgctactctaccgataccacctgtatgcagccacacattcggtccttgagatgacc
atctggacgcaccgtgtccacttcctagaggaacaagtcctacctcactggaagtccttc
accatctggaatgcaggcaagcaggggcgtaagttataccgcagcctgactgcagccagc
cggcacaaggtggtggccttctgtgacgttgatgagaacaagatcaggaagggcttctac
tgctacgaagactcacaggaaagacccaagccaaaggtccccatcctgcatttccaagct
gcccagtctccctttgtcatctgtgtgaagctggacctcacaggaggtgagtttgaagac
aacttgaagtcgctggacttgcaggaaggccgggacttcgtccatttcagctga

DBGET integrated database retrieval system