KEGG   Mus musculus (mouse): 210009
Entry
210009            CDS       T01002                                 

Gene name
Mtrr, 4732420G08, MSR
Definition
(RefSeq) 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
  KO
K00597  methionine synthase reductase [EC:1.16.1.8]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    210009 (Mtrr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.8  [methionine synthase] reductase
     210009 (Mtrr)
SSDB
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5 Flavodoxin_3 tRNA_m1G_MT
Other DBs
NCBI-GeneID: 210009
NCBI-ProteinID: NP_001295404
MGI: 1891037
Ensembl: ENSMUSG00000034617
UniProt: Q8C1A3 A0A0R4J0G9
Position
13 B3; 13 35.54 cM
AA seq 696 aa
MRRFLLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYDLKTETGPLVMVVSTT
GTGDPPDTARKFVKEIHNKTLPTDYFAHLQYGLLGLGDSEYTYFCNGGKVIDKRLQELGA
QRFYDTGHADDCVGLELVVEPWIDGLWAALTKHFKSLGGQENMSDTLSRASDAPLSTAMK
PELLHIQSQVELLRLEDMGERDSELREQNETNRGQQGRIEDFDSSLVHSVPPLSQSSLSI
PAVPPEYLEVHLQESLGQEENQASVPSGDPSFQVPISKAIRLTTNDAVKSTLLLELDISK
IEFSHQPGDSFNVTCPNSDREVEELLQRLQLADKRAHRVILKIKTDTKKKGAALPAHVPE
GRSLQFILTWCLEIRAVPKKAFLRALAEHTSSATEKRRLQELCSKQGAADYNRFIRDASV
CLLDLLLTFPSCQPPLSLLLEHLPKLQPRPYSCASSSLRHPDKLHFVFNIVEFPPSTTAA
SLRKGVCTGWLATLVAPFLQPNTDVSNVDSGDALAPEIRISPRATNAFHLPEDPSAPIIM
VGPGTGVAPFVGFLQHREKLQEQHPDGKFGAMWLFFGCRHKDRDYLFREELRHFLKTGVL
THLKVSFSRDAAPDGEEAPAKYVQDNLQRHSQQVARTLLQENGYVYVCGDAKNMAKDVND
TLIGIISNEAGVDKLEAMKTLATLKQEKRYLQDIWS
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgagaaggtttttgttactttatgctacacagcgaggacaggcaaaggccatagcagaa
gaaataagtgagcaggctgtgtcacacgggttttccgcagatcttcactgtatcagtgag
tcagaaaagtatgatctgaaaacagaaactggccctctggtgatggttgtatctaccacg
ggtacaggagacccacctgacacagcccggaagtttgttaaagaaatacacaacaagaca
ctccccacggactattttgctcacctgcaatatggattattgggcttgggtgactcagaa
tacacatacttctgcaatggagggaaagtaattgataaacgacttcaggagcttggagcc
cagcgtttctacgacaccggacatgccgatgactgtgtcggtttagagcttgtggtagag
ccgtggattgatggactctgggctgctctcacaaagcactttaagtcactcggaggacaa
gaaaacatgagtgacacactctcacgagcatcagatgcccccttgagcactgccatgaag
ccggagttgttgcacatccagtcacaagttgaactgctgagattagaggacatgggggaa
agggattctgagcttcgggaacaaaatgagacaaacaggggtcagcagggtcggatcgaa
gactttgactcctcgcttgtgcactcggtccccccactctcccagagctctctaagtatt
cctgctgtgcccccagagtatttggaggtccatcttcaagagtctcttggccaggaggaa
aaccaagcatctgtgccttcaggggatccaagttttcaagttccaatttcaaaagccatt
cggctgactacaaatgatgccgtaaagagcactctgctgttggaactggacatttcaaaa
atagagttttcccatcaacctggagactccttcaatgtgacctgtccaaacagtgatcgt
gaggtagaagaactgctccaaaggctgcagctggctgataaacgagctcaccgtgtcatc
ttgaaaattaagacggacactaagaagaaaggagctgccctgcctgcgcatgtgcctgag
gggcgttctctccagttcatcctcacctggtgtcttgaaatacgagcagttcctaaaaag
gcctttttgcgggcccttgccgagcacaccagcagtgccactgaaaagcggaggctgcag
gagctgtgcagtaaacaaggagccgctgattacaaccgcttcatccgagatgccagcgtc
tgcctgctggacctcctgctcaccttcccgtcctgccagcctccgctcagcctactgctg
gagcaccttcctaaacttcagcctcgaccgtactcatgtgcaagctccagcttacgtcac
ccagacaagcttcacttcgtgtttaacatcgtggagttcccacctagcaccactgcagcc
tccctgaggaagggagtgtgcacgggctggctagccacattggttgctccattccttcag
ccaaacacagacgtttcgaatgtagacagtggtgacgctctggctcctgagatacgtatc
tctcctcgggcaacaaacgctttccacttaccagaggacccgtcggcccccatcataatg
gtgggtccaggaactggcgtagccccctttgttggcttcctccagcacagagaaaaactt
caagaacaacacccagatgggaaatttggagctatgtggctgttctttggctgcagacac
aaggacagagactacttgttcagggaggagctcaggcatttcctcaagactggggtcttg
actcatctgaaggtctcgttctcaagagacgctgcccctgacggggaggaggccccagca
aagtatgtgcaagacaacctccagcggcacagccagcaggtggccaggaccctccttcag
gagaatggctacgtttacgtgtgtggagacgccaagaatatggccaaggacgtgaacgac
accctcataggaatcataagcaatgaagctggtgttgacaaactagaagcaatgaagacg
ctggcaacgttaaagcaagagaaacgatatctgcaggacatctggtcctaa

DBGET integrated database retrieval system