KEGG   Mus musculus (house mouse): 210162
Entry
210162            CDS       T01002                                 
Symbol
Zkscan2, 9430065N20Rik, AW493225, Zfp694
Name
(RefSeq) zinc finger with KRAB and SCAN domains 2
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    210162 (Zkscan2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    210162 (Zkscan2)
SSDB
Motif
Pfam: zf-H2C2_2 Myb_DNA-bind_4 SCAN zf-C2H2 zf-C2H2_4 Myb_DNA-binding zf-C2H2_11 zf-C2H2_jaz Myb_DNA-bind_3 MADF_DNA_bdg zinc_ribbon_15 Zn-ribbon_8 zf_UBZ
Other DBs
NCBI-GeneID: 210162
NCBI-ProteinID: NP_001074798
MGI: 2444060
Ensembl: ENSMUSG00000030757
UniProt: G3X952
Position
7:complement(123074607..123105685)
AA seq 960 aa
MATVMNPQIDVEVEECLIMKVEKDSEWVSEPILERSGSTECESFRKCFRQFCYEDVTGPH
EAFSKLWELCCRWLKPEMRSKEQILEQLVIEQFLTILPEKIQTWAQKQCPESGEEAVALV
VHLEKETRRLRKQVSSPLPSEKQAPPRTVWEVADFEPEQLETQHRVVSLEEAGSLHSGHQ
EQLNQKREHRPLPKNAHSSVWVPVPSDEWNALDEEVTTQEPIRDVHTERSFSYKKSVQQV
PAHRGLYHEIRKESAGSMVSLGDSVSAPNKIAQLEQKKEPWSVGLHSSNKRNSVLQSNYI
KEKSVHAVQIPARNAGKVWREQQQWGLEDEKIAGVHWSYEETKTFLAILKESRFYETLQA
CPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHMLEPCAFFEDMDALL
NPAAHTSSTERPKVVISLPLKRTAISAKEQVSLVEEEEGAEDSDGDEVGIEFIRKSEIRA
APVLFQNLSGVHWGYEETKTFLDILQETRFYEALQACHRKSKLYGVVAEQLRECGFLRTP
EQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALVNCRPSSLSTNTSEEVPSLSRQERG
HIEVEPREPTTWEPVETPQEAVLEDSGSERLSEEEMIEEPELEGPSGLLQSPAGFEIGTI
IKEDPTQVMFKDTEPHRVLMEKPKRLVSQNTNPSKYCKREYFSGRHCENLQGVRQGKLMS
QPRDTGKAVVHQRPCVGRRPYRLLKYGENFGRSARLVCRMTHQKENPFKCGVCGKCFGRS
RSLIRHQRIHTGEKPFKCPDCGKSFNDSSNFGAHQRVHTGEKPYRCRECGKCFSQSSSLI
IHQRTHTGEKPYQCEECGKSFTNSSHFSAHRRIHTEENPYKCGDCEKSFNNCARFREHQR
IHNGEKPYTCAQCGKHFNKSSFLTKHREVHMREKLLPYSPSVYSPENLLKGKSAELRKTF
NT seq 2883 nt   +upstreamnt  +downstreamnt
atggctactgtcatgaaccctcagatcgacgtggaagttgaggagtgcctcataatgaaa
gtggaaaaggactccgagtgggtatcggagcccattctggaaagatcaggcagcactgaa
tgtgagtccttccgtaaatgcttcaggcagttctgttatgaggatgtgacaggaccccat
gaagctttcagtaaactctgggaactctgctgtcggtggctgaagccagaaatgcgttcc
aaggaacagatcctcgagcagctggtaatcgaacagtttctcaccattctgcctgagaag
attcagacctgggcgcagaagcaatgtccagaaagcggagaggaggcggtggccctagta
gtgcatttggagaaagagaccagaagacttcgaaagcaggtcagtagccctctgccttca
gagaagcaagccccacctagaactgtgtgggaagtagctgactttgagccagagcaactg
gagacccagcacagggttgtttctctggaggaagctggaagcctccactcaggacaccaa
gaacagctgaaccaaaaaagggaacataggccattacctaagaatgctcactcttctgtc
tgggttcctgtccctagtgatgagtggaatgctctcgatgaggaagtgacaacccaggaa
ccaataagagatgtccacacagagagaagcttttcctacaaaaaaagtgtacagcaagtt
ccggcgcacagaggtctctaccacgaaatcaggaaggaaagtgcagggagcatggtttcc
ctgggagactctgtgtctgcacctaacaaaatagcccagttggaacaaaaaaaggaacca
tggagcgtaggtcttcattcctcaaacaagaggaatagtgtcctgcaaagcaactacatc
aaagagaagtcggtccatgctgttcagatcccagctaggaatgcagggaaagtgtggcga
gagcagcaacagtggggtttggaagatgaaaagattgcaggtgtgcactggagctatgaa
gaaaccaagacttttcttgcaattctcaaggaatctcgcttttatgaaacactccaggct
tgtccccgaaatagccaggtatatggtgctgtggctgaatggttgcgagaatgtggcttc
ctccgaacaccagagcagtgccggaccaagttcaaaagtcttcagaagagttatcgaaaa
gtgagaaatggccacatgctagaaccctgtgccttctttgaggacatggatgccttgtta
aaccctgcagcccacacttcatctactgagaggccaaaggttgtgatctctctcccacta
aagagaactgctattagtgctaaagagcaggtcagtttggtggaggaggaggaaggtgct
gaagactccgatggtgatgaagtgggcattgagtttatacgcaagtctgaaatccgtgct
gcccctgtcttatttcaaaacctaagtggtgtgcattggggctatgaagaaaccaagact
tttcttgatatccttcaagagacccgattttatgaagcacttcaagcctgccatcggaag
agcaaattgtatggagtcgtggctgaacaacttcgagaatgtggctttctccggacacca
gagcaatgccgaaccaagttcaaaagccttcagaagagttaccgaaaagtgaagaatggc
catgtactggagtcctgtgcattttacaaggagatggatgccctggttaactgccgtcca
tcctccctttccaccaacacctcagaagaagtcccatccctctcaaggcaggaaagggga
catattgaggttgaaccccgagagcctacaacctgggaacctgtggagaccccacaggaa
gcagtgttagaagattctggcagtgagagactgagtgaggaggaaatgatagaagagcca
gaacttgaaggaccttcaggcctgctgcaaagcccagctggttttgaaattggaactatt
attaaggaagacccaacacaggtaatgtttaaggacacagagccccatagggtattaatg
gaaaaacctaaaagacttgtttcccagaatactaaccccagtaaatactgtaaaagggag
tacttctcaggaagacactgtgaaaaccttcaaggagttagacagggaaagctgatgtct
caacctagagatacagggaaggctgtggtgcatcagaggccttgtgtggggaggagacca
tatagacttctcaaatatggggaaaactttggaaggagtgcccgtcttgtgtgcaggatg
acccaccagaaggagaatccttttaagtgtggtgtctgtgggaagtgctttggtaggagc
aggagccttatcagacaccaaagaatccacactggggaaaagcctttcaaatgtcctgac
tgtgggaaaagctttaatgactcctcaaattttggagcccaccagagagtccatactgga
gagaagccgtacagatgcagggagtgtgggaaatgcttcagccagagctcaagtcttatc
atccatcagagaacccacactggtgagaagccctatcagtgtgaagagtgtgggaaaagc
ttcaccaacagttctcacttcagtgcccaccgcagaatccatactgaagagaatccctac
aaatgtggggactgtgagaagagcttcaataactgcgcaaggttccgagaacaccagcga
atccacaatggagagaagccctacacatgtgcccagtgtggcaaacatttcaataagagc
tctttcctcactaaacaccgggaagtccacatgagagaaaagctgctgccatactccccc
tctgtgtactccccagagaacctactgaaaggcaagagtgccgagctcaggaagaccttt
tga

DBGET integrated database retrieval system