KEGG   Mus musculus (mouse): 210356Help
Entry
210356            CDS       T01002                                 

Gene name
Nckap5, 8430408F21, D130011D22Rik, E030049G20Rik, Erih1, Erih2, Gm1548, Nap5
Definition
(RefSeq) NCK-associated protein 5
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: NCKAP5
Motif
Other DBs
NCBI-GeneID: 210356
NCBI-ProteinID: NP_001075225
MGI: 2686394
Ensembl: ENSMUSG00000049690
Vega: OTTMUSG00000030251
UniProt: Q8C6S8 Q6NZK2 E9QAE1
Position
1; 1 E3
AA seq 1909 aa AA seqDB search
MEGKRQLDRRDFGKRLSLDSSLVEYMDSNKCIEHLLAQLREQHRSLWREKLAVARLQREV
AQRTSQGAMHEKLIHELEEERHLRLQSEERLREVTLESERNRIQMLGLQQQFSRMEETVR
SLLQSQGSPEQKKEEPAKITAYQEGLPDEERKEQAALGDLHVVAADEDSRSEHSSVEEGK
EDSRLLLKRLKALEAENSALALENENQREQYERCLDEVANQVVRALLTQKDLREECVKLK
TRVFDLEQQNRALSLLFQQRVRPASDVLLQEHLQNAKSGTPALKHSGSGVVIPDHLCPRN
SCSSGSELSLSSTCSEYSSGSSYTWQDRKLIGKRQSSRIWDKRLSIDSSLPSGFASPADE
LPPTRIKESHILEGLRKLQKRKVFLESPSLVISKWGYKDCMNSNEGIYSPGIKTSSLKEC
PPCQPSGMGIPCQNLHQTFIYDANSHEDAHEELPSSALPLTSPSQGYRIQGSKLTHSVSD
SLFNWEPHRKYFAEGTASVYTREMPERLARCASHCPLERKLCPSIHLPWVQRDRDPHSQV
HGHVPLNLQLSDTDDNETLNELHIESSDERSPSDLSLTGDTDKSMENLEVGFRKSEGGSR
DMGEEACPTHLETSPKAFSFIKQQRVVKRTSSEECVTVIFDAENGEPVEFSSHQAGVVTV
TRDEISISSALAGPSEELTELSPQEITHFQAGATARDCPFLKRPEEETAKNIPKDENHIL
TAPNDFFSSQTIITQNSPRPKLAKPTQGVAWQSNSRPVGNMGVYTKQGLTKIPSRGKSSP
QKSKLVESMPTMLVPSSALVTPEKTPASPMGKLSQCRKAESPGSLCDVQPESHIPKHPAQ
VPHIPKISNKKNWVQCPRSQTSGIQSRHLMGRSDSSEMRSNGCVSAPQTRMRSPSPPTPP
GRSVSLLVRPSYDYPPLPSPAKPETQGPGDAVSPGLKSPLLKGSSAPLVSSSPVMSEIQK
KPSVASRKSAFPPALPSTQAVVHTRYPEHIASSPFAVTTSGPPKVSPKRGIPKPPPHHAL
GTAHMDTDLQTPKTCPSSCELLEVTSCKSLSPGRKRQLSDSTVMPHRPSFSGVNESLTPQ
VNSPSSSSSSCRNQGSSQGGQNSPEKGPKTRLPVGLKVLMKSPQLLKKTSLVPGKQEKDS
LNEASRSCVAANTSNPEDSKDPASLETSRDERTTALLGVRGPDSLARGLALDSTMPESLE
CSISRDDGRDGADSRAIKRSFSSSKPHLKPALGMNGAKARSQSFSIHLGEKPSTPPTEGP
GKIRTQIITNTAERGNSLTRQNISMEGSPSKTPSVSTSDNLPNAGRPLGNPFSRQSSLCS
TGSSSSQHGSPSKLPLRMLTRPEGLLTPGVEDQRLSTQEECPERGVHEQSSSDHHRHPSP
LSDCPQFLHVPGRMQRPSNLETSGISKLETSGRHPDASSTGTSVVSPEAPLSPSIEEKVM
LCIQENVEKGQVQTKSASVEVKPRAGPSFTSWFGFRKSRLPALSSRRMEASKSKVEKKDT
KLKSERKKEKKKAEVQSKIENELSRGTKKADGQSPDDGLQSSESLKVSQDIYNQMKLEPR
NRPSPAVCPTKDAFMTELLNRVDKRASVQRESGSKGVSCRSVLEGTSQGSCFASGSVSTQ
GSQKKNIKTKVDMEKPRESLGAEVNEDVQEDEEDRVADTTLQSHMIESNCQMRTLDSGIG
TFPLPDSGNRSVGRYICQQDSPEDTDALLPLQPAASMASSARAQTLDREVPSSTDSQSSP
ESMIIHSISDPSMMAREMRASQSHLPKPTSSGKPSFEKQNGAESKAHTGPSFEYAEDAVA
SEPLSGWRGEDATTETQEPKQVEETKEDPENRLSEISLESFNKFSSNTVILLGKEKSPSE
VEGQKEEKGKKTEVSSSSSERPGVDRVESLSDSLYDSFSSCASQASNEA
NT seq 5730 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaagagacagctggatagaagggactttggtaaaagactctctctggacagc
agtcttgtggaatacatggactctaacaaatgcatcgagcacctgctggcacaactcagg
gagcaacacagaagtctctggcgggagaagctggctgtggccaggctgcagagagaagtt
gcccaaaggacaagccaaggggccatgcacgagaagctgatacatgagttggaagaggaa
cggcacttgcggctacagagtgaggagcggctgcgggaggtgaccctggagtcagagcgc
aacaggatccagatgctcggcctgcagcagcagttttccagaatggaagaaactgtccga
agtctgttgcagagccaaggatctccagagcagaaaaaggaagaacctgccaagatcaca
gcctaccaggaaggactacctgatgaagagagaaaagagcaagcagcactgggtgatctc
catgtggtggcagctgatgaggactcaagaagcgagcacagtagtgtggaggagggaaag
gaagacagcagactgctcctgaagagactgaaggccctggaggcggagaattcagcactg
gcactggaaaacgagaatcagagagaacagtatgagcgatgtcttgatgaggtagccaac
caagttgttcgagctctactcactcaaaaggatctgagggaggagtgtgtaaagttgaaa
acaagagtgtttgacttggagcaacagaaccgagcactcagcctcctgttccaacagcga
gtcagaccagcttctgatgtgcttctccaggaacacctccagaatgcaaaatcaggaacc
cctgccttgaaacactctggctcaggggttgtcatccctgatcacctctgtcctcgcaac
agctgcagcagtggcagtgagctatcgctgtcaagcacctgcagcgagtactccagtggc
tcctcctacacgtggcaagacaggaagctcattgggaaaaggcaatcatcgcggatctgg
gataaaagactaagtattgattcttcgctcccaagtggcttcgccagccctgcagatgaa
ctacctccgacccgtatcaaagaaagccacattctagagggactgaggaagctacagaag
cggaaagtgttccttgaatcaccatcattggtgataagcaaatggggttataaagattgc
atgaactcgaatgaagggatctattcgccaggaattaaaaccagcagcctcaaggagtgt
ccgccctgccaaccgtctggcatggggatcccctgccagaatctccatcagacattcatc
tatgatgcaaattctcatgaggatgcacatgaagaactcccatcctcagccttgccacta
acatctccgagccagggctacagaatacagggcagtaaattgacacacagtgtttcagac
agtctgtttaactgggagccacataggaagtactttgcagaaggtacagcctcagtatat
accagagaaatgcctgaaaggctagctcgttgtgctagccactgccccttggagaggaag
ctatgtcccagtatacacctgccctgggtgcaaagagacagggacccacacagccaagtt
catggccatgtgcctctgaacctgcagctctcagataccgatgacaatgagaccctaaac
gagctacacatagagagcagtgatgagagaagcccttcagacctgtccttgactggggac
accgacaagtccatggagaacctagaggtgggattcagaaagtctgaaggtggctctcgg
gacatgggagaagaagcatgtcccacccacttagagactagcccgaaggcattcagtttc
atcaagcaacaaagggttgtcaagaggacctcttcggaagaatgtgtcacggtcatattt
gatgcagaaaatggagagccagtggaattcagctctcaccaggctggagtcgtcactgtc
accagggatgaaatttccatcagctcagcccttgctgggccctcagaggaactcactgaa
ctttcacctcaggaaattactcacttccaggcaggagctactgcaagagactgtcctttt
ctgaagagacctgaagaggagactgcgaaaaacattccaaaagatgaaaatcatattctc
acagctccgaatgacttcttcagctcccagactataataactcagaattccccaagacca
aagctcgccaaacccacacagggggtagcctggcagagtaattctagacctgttggaaac
atgggtgtctacacaaagcaaggtctgacaaaaatcccttccagaggcaagtcttcacct
cagaaatccaaacttgtggagtctatgcccaccatgctggtcccctccagtgccctagtg
actcctgaaaagacaccagcatcccctatggggaaactctcacaatgtagaaaggcagag
agccctggttctctctgtgatgtacagccagaatcacacattccaaaacaccctgcccag
gttcctcatatccccaaaatttccaataagaagaactgggttcagtgccccaggagtcag
acttcagggatccagtcacggcatctcatggggagaagtgacagtagtgaaatgaggtcc
aatggctgtgtctctgcgccacagacaagaatgaggtctccctcccctccaacccctcca
gggagatcagtgtcactcctggttagacccagttatgattacccaccactaccatcacct
gccaaacctgaaactcagggccctggagacgctgtaagtccagggttgaaatccccgctg
ttgaaaggatcctctgctcctcttgtctcttccagtccagtgatgtcagaaatacagaag
aaaccatctgtggcctccagaaagtctgccttccctccagctcttccctcaacccaagcg
gtagtgcacaccagataccctgaacacatagcctccagtccatttgctgtgacgacttca
gggcccccaaaagtctctccaaaaagaggcatccctaaacctccccctcaccatgcacta
ggaactgcccacatggacacagacttacagacacccaagacttgtccttcaagctgtgaa
ctgctagaggtgacatcttgtaaaagcctgtctccagggagaaaaagacagttgagtgac
agcactgtgatgccccacaggccttccttctcaggagtgaatgagtccttgacacctcag
gttaacagtccatcctcctcttcctcatcctgtagaaaccaagggtcctcacaaggtggc
cagaactctcccgagaaaggacctaaaactcgcctcccagtaggactcaaagttctcatg
aagtctcctcagttgctcaagaaaacttccttggtaccagggaaacaagaaaaggatagt
ttaaatgaagcatctcgaagctgtgtagcagcaaacacgtctaatcctgaggactccaaa
gaccctgcaagtctggagacctcaagagatgagagaaccacagccttactaggtgtgaga
ggtcccgacagtctagctagaggacttgccttagactcaacaatgccagaatcgttagaa
tgtagcatctccagagatgatggaagagatggggcagacagcagagccataaaaagatcc
ttctcctccagcaagccacacctaaagcctgctctaggcatgaatggagccaaagctcgg
agtcagagcttcagcatccacttgggagagaagccttccacacccccaacagaagggcca
ggcaagattcgaactcagattatcaccaacacggctgaaagaggcaactccctcaccaga
cagaatatctcaatggaagggtccccaagcaagaccccctctgtctcaacatctgataat
ctgcccaatgctggaaggcccctgggaaaccccttttccaggcagagttctctctgtagc
accggaagttctagcagccagcacggaagcccaagcaagttacccttgaggatgctcaca
aggccggaaggactcctcactcctggagtggaagaccaacggctctctactcaggaagag
tgtcctgaaagaggtgtacatgagcaatctagcagtgaccaccataggcatccatctcct
ctttcagactgccctcagttcctgcacgttccagggaggatgcagcgcccaagcaatttg
gaaacaagtgggatatctaagctagaaacttctggaaggcatccagatgcttcttcaact
gggactagtgtcgtgagcccagaagcccccctctcaccctccatcgaagaaaaggtcatg
ttgtgcattcaggagaatgtggaaaagggccaagtgcagacaaagtctgcctctgtggaa
gtgaagcccagggcagggccttcgttcaccagctggtttggttttcgaaagagcaggctt
ccagctctcagtagcaggagaatggaagcttccaagagtaaagtggaaaagaaagacaca
aaactgaaatctgagaggaaaaaagaaaagaagaaagctgaagtacaatcaaagatagaa
aacgaactgagtagggggaccaagaaggcagatggtcagagtccagacgatggtctgcaa
agctcagagagtctgaaagtatcccaagacatttataaccaaatgaagttggagccaagg
aatagacccagccctgctgtgtgcccaacaaaagatgccttcatgacagaacttctaaac
agagttgataagagagcctcggtacagagagagagtggatcaaagggtgtttcctgcagg
agcgtgttagagggcacctcccagggctcctgtttcgccagcggctctgtgagcactcaa
ggaagtcaaaagaaaaacatcaaaaccaaagtcgatatggaaaaaccaagagaatccttg
ggggccgaggtcaatgaagatgtacaagaagatgaagaagatagagttgctgacactact
ctccagagccacatgatagaatccaactgccagatgagaacactggacagcgggattgga
acctttcccctcccagactcaggaaaccgctcagtgggacgatacatatgccagcaggac
tctccagaggacactgatgccctcctgcctctccagccagccgcttccatggcatcctct
gccagagcccaaacccttgaccgcgaagtgccttcctccacagacagccagagctccccg
gagtccatgatcatccattccatatctgaccccagcatgatggccagagagatgagagcc
tcacagagtcaccttcccaagcctacctcctcaggaaaacctagttttgaaaagcaaaat
ggagcagagtcaaaggctcacactggcccatcattcgaatatgctgaggatgcagtggca
agtgagcccctttcaggatggaggggtgaagatgctactactgagacccaggaaccgaaa
caagttgaagaaacaaaagaagatcctgagaatagattatctgaaatttccctggagtca
ttcaataaatttagcagcaatactgtgattttattaggaaaagagaagtctccaagtgag
gttgaaggacaaaaggaagagaaaggcaaaaagacagaagtgtcttcgagtagctccgaa
cggcctggggtggaccgcgtggagtctctgagtgactctctgtatgacagtttctcctct
tgtgcaagtcaagcatccaacgaggcctag

DBGET integrated database retrieval system