KEGG   Mus musculus (mouse): 210529Help
Entry
210529            CDS       T01002                                 

Gene name
Mettl14, G430022H21Rik, mKIAA1627
Definition
(RefSeq) methyltransferase like 14
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    210529 (Mettl14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     210529 (Mettl14)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     210529 (Mettl14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 210529
NCBI-ProteinID: NP_964000
MGI: 2442926
Ensembl: ENSMUSG00000028114
Vega: OTTMUSG00000037048
UniProt: Q3UIK4
Position
3; 3 G1
AA seq 456 aa AA seqDB search
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAP
NSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYC
QHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIR
ELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEG
LDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTV
GPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatagccgcctgcaggagatccgggagcggcagaagttacggcggcagctcctagct
cagcagttgggagctgagagtgcggatagcattggtgctgtgttaaatagcaaagatgaa
cagagggagattgctgaaaccagagaaacctgcagggcttcctatgatacatctgctcca
aactcaaaacggaagtgtctggatgaaggagagactgatgaagacaaagtagaagaatat
aaggatgaactggaaatgcagcaggaggaagagaatttgccatatgaagaagagatttac
aaagattccagtacctttcttaagggaacgcagagcttaaatccccataatgattactgc
caacattttgtagacactggacacagacctcagaatttcatcagggatgtaggtttagct
gacagatttgaagaataccctaaacttagggaactcatcagactaaaggatgagttaata
gctaagtcaaacactcctcccatgtacttacaagcagacatagaagcctttgacatcaga
gaattgacacccaaatttgatgtgattctcctggagccccctctggaagaatactataga
gagactggcatcactgcgaatgagaaatgctggacctgggatgatattatgaagttagaa
atcgatgagattgcagcacctcggtcatttatatttctctggtgcggttctggggaagga
ttggaccttgggagagtatgcttgcgaaagtggggttacagaagatgtgaagatatttgt
tggattaaaaccaataaaaacaatcctggaaagacaaagactctagatccaaaggcagtt
ttccagagaacaaaggagcattgcctgatggggatcaaaggaaccgtgaagcgaagcaca
gacggggacttcattcatgctaatgttgacattgacttaattatcacagaagaacctgag
attggcaatatagaaaaaccagtagaaatttttcatataatagaacatttttgtcttggt
agaagacgccttcatctctttgggagagatagcactatcaggccaggctggctcacagtt
ggaccaacgcttacaaacagtaactacaatgcagaaacatatgcatcgtatttcagtgcc
cccaactcatacttgaccggatgtacagaggaaatcgagaggcttcgaccgaagtcacct
cctcccaagtccaagtctgaccgtgggggtggagctcccagaggtggaggaaggggggga
acatctgctggccgtggtcgggaaagaaaccgatccaatttccgaggagagagaggtggc
tttagggggggccgtggaggcacgcacagaggcggctttactcctcggtag

DBGET integrated database retrieval system