KEGG   Mus musculus (house mouse): 210582
Entry
210582            CDS       T01002                                 
Symbol
Coq10a, Gm1
Name
(RefSeq) coenzyme Q10A
  KO
K18588  coenzyme Q-binding protein COQ10
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    210582 (Coq10a)
SSDB
Motif
Pfam: Polyketide_cyc Polyketide_cyc2
Other DBs
NCBI-GeneID: 210582
NCBI-ProteinID: NP_001074509
MGI: 2684847
Ensembl: ENSMUSG00000039914
UniProt: E9Q3H6
Position
10:complement(128198965..128207037)
AA seq 259 aa
MASAGARRLPAPTRAAARSCCGFSLCRGARSVPTPPPGPPRPPRPMRFLISCNLFLPRAA
QALAAEAGLPHSRSFMGFAAPFTNKRKAYSERRIMGSSASDSSCCRYSMQEMFEVVSNVQ
EYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFN
HLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATK
FGPETAIPRELMFHEVHQT
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcctctgcgggcgcgcggaggctcccggccccgacgcgcgcggccgcccggagctgc
tgcggcttctcgctctgccggggcgcgcgctccgtcccgaccccgcccccgggccctccg
cggccgccgcgtccaatgaggtttctgatttcctgtaatctcttcttgcctcgcgctgcc
caggccttggcagcggaggctggcctacctcatagtcgttccttcatgggctttgctgcc
ccctttaccaacaagcgaaaggcttactcggagcgtaggatcatgggttcctcggcctct
gattcctcttgctgtaggtactcaatgcaggagatgtttgaggtggtgtccaacgtccag
gagtaccgagagttcgtgccgtggtgtaagaagtcactggtagtatccagccgtaagggt
cacctgaaagcccaattggaggttgggtttccacctgtcttggaacgttacacctctgcc
gtctccatggtcaaaccacacatggtcaaggctgtttgcactgacggcaagctcttcaac
cacttagagactatttggagattcagccctggtattccctcctaccctcgaacctgcact
gtggacttctcgatttcctttgagtttcgctctctgctccactcccagctggcgaccatg
ttttttgatgaggttgtaaaacagaatgttgctgcctttgagcgccgggcagcaaccaag
tttggtccagaaacagccatcccccgtgaactcatgtttcatgaagtgcaccaaacttga

DBGET integrated database retrieval system