KEGG   Mus musculus (mouse): 210757
Entry
210757            CDS       T01002                                 

Symbol
Themis, E430004N04Rik, Gasp, Spot, Tsepa, thylex
Name
(RefSeq) thymocyte selection associated
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CABIT
Other DBs
NCBI-GeneID: 210757
NCBI-ProteinID: NP_848781
MGI: 2443552
Ensembl: ENSMUSG00000049109
Vega: OTTMUSG00000034168
UniProt: Q8BGW0
Position
10; 10 A4
AA seq 636 aa
MALSLEEFVYSLDLRTLPRVLEIQSGIYFEGSVYEMFGNECCLSTGEVIKITGLKIKKMM
AEICEGAIGGCESQKPFELPMNFPGLFKVMADKTPYLSIEEITRTVNIGPSRLGHPCFYH
LKDIKLENLIIKQGEPIRFNSVEEINGETLVNCGVVRNHQSHSFTLPLSQEGEFYECEDE
HIYTLKEIVEWKIPKNRTRTVKLTDFSNKWDSTNPFPEDFYGTLILKPVYEIQGVLKFQK
DIVRILPSLDVEVKDITDSYDANWFLQLLSTDDLFEMTSKEFPVVAEVVEISQGNHLPQS
ILQREKTIVIHKKYQASRILASEIRSNFPKRHFLIPISYKGKFKRRPREFPTAYDLQIAK
SRKETLHVVATKAFHTLHKELSPVSVGDQFLVHHSETTEVVFEGTRKVNVLTCEKVLNKT
REDAQLPLYMEGGFVEVIHDKKQYQISELCTQFCWPFNVKVAVRDLSIKDDILAATPGLQ
LEEDITDSYLLISDFANPEECWEIPMSRLNMTVRLVNGSSLPADAGLLQVRSFVEEITEE
QYYMMRRYESSLSHPPPRPPKHPSAEEMKLTLLSLAEERTINLPKSLKSHHVDRPKKLPS
DESGQDSRAPVGFQNDVADVERQKSKHGPLQPQAPL
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggctttatctctggaagaatttgtctactcccttgacctgaggaccctccccagggtc
ctagaaatccagtcaggcatctactttgaagggtctgtttatgagatgtttggcaatgaa
tgctgtctgtcaacaggagaagtgattaaaatcaccggtctcaaaattaagaagatgatg
gctgaaatttgtgagggcgctattggaggttgtgagtctcagaagccttttgagctgccc
atgaattttccaggtctctttaaggtcatggctgataaaactccatacctgtcaattgaa
gaaatcacaagaaccgttaatattggacccagcagactaggtcatccttgcttttatcac
ctgaaggatataaaactagagaatctcattattaagcagggtgagccaatccggttcaac
tcagttgaagagattaatggagaaacgctggtgaattgtggtgtggtaaggaatcatcag
agccactcatttactttgccattgtcacaagaaggagaattttatgagtgtgaggatgaa
catatctataccctaaaagaaattgttgaatggaagattcccaagaacagaacacggaca
gtgaaacttacagatttctcgaataagtgggactcaaccaatccattcccagaagacttt
tatggtacactgattctcaaacctgtttatgaaatccaaggtgtgctgaaatttcaaaag
gacatagtccggattctcccaagtttagacgttgaagtcaaagatattactgattcttat
gatgctaactggtttcttcagttgctgtctacggacgacctttttgaaatgaccagcaaa
gagtttcctgtagtagctgaagttgtcgaaatatctcaagggaaccacctgccccaaagt
attttgcagcgagagaaaaccattgtcatccacaaaaagtaccaggcttcgaggatctta
gcttcagaaattcgcagcaatttccctaaaagacacttcttgatccctattagctacaaa
ggcaagttcaaaagaagaccacgggagttccccacggcctatgacctgcagatagctaag
agcaggaaagaaactctccacgtggtggccaccaaagctttccatacacttcacaaggag
ctgtcccctgtgtctgttggagaccagtttctagtgcatcattcagagaccacagaagtt
gtctttgaggggacaagaaaagtaaacgttctgacctgtgaaaaagtcctcaataagacc
cgtgaagatgcacagcttcctctatacatggaaggaggttttgtagaggtgattcatgat
aagaaacagtatcagatttccgagctctgtacccagttttgctggcccttcaatgtgaag
gtggctgtgagagatctctccattaaagatgacattttggcagctaccccaggacttcag
ttagaggaggacatcacagattcttatctacttatcagtgactttgcaaatcctgaggaa
tgttgggaaattcccatgagccgcttgaatatgactgttcgactagttaatggtagcagt
ttgcctgcagatgcagggctacttcaagtcaggagttttgtagaagagattacagaagaa
cagtattacatgatgaggaggtacgaaagttctctatcacatcccccacctcgccctccc
aaacatccctcagctgaggaaatgaagctcaccttgctcagcttagcagaagagagaaca
ataaatctgcccaagtctctcaagagtcaccatgtagacagacccaagaagcttccctca
gatgaaagtggccaggattcaagagctccagttggttttcagaatgatgtggctgatgtg
gagagacagaagagcaagcatgggccactgcagccgcaagcaccactgtga

DBGET integrated database retrieval system