KEGG   Mus musculus (mouse): 210801
Entry
210801            CDS       T01002                                 

Symbol
Unc5d, D930029E11Rik, Unc5h, Unc5h4, mKIAA1777
Name
(RefSeq) unc-5 netrin receptor D
  KO
K07521  netrin receptor unc-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    210801 (Unc5d)
SSDB
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 TSP1_spondin ig Ig_2 TSP1_ADAMTS V-set Ig_6
Other DBs
NCBI-GeneID: 210801
NCBI-ProteinID: NP_694775
MGI: 2389364
Ensembl: ENSMUSG00000063626
Vega: OTTMUSG00000061092
UniProt: Q8K1S2
Position
8; 8 A2- A3
AA seq 956 aa
MGTGAADGSRGARRWLPWLGLFFWAAGAAAARGADGSEILPDSIPSAPGTLPHFIEEPED
AYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQ
VEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRP
PEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRS
LSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCT
ALCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILD
KKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDS
SALTGGFQTFNFKTVRQGNSLLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNP
LSDIKVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNNRGFSTIHPRNKTPYIQNLSSLP
TRTELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEV
LLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSC
YCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTP
CAFQEVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQEVPFSR
VWSSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQ
EDSTFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSP
SAVILNLWEARHQQDGDLDSLACALEEIGRTHTKLSNITEPQIDDADFNYSRQNGL
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggggacaggggctgcagacggcagccgcggggcgcgccggtggctcccatggctagga
ctctttttctgggcggcgggggctgcggctgcccgaggagccgatggcagtgaaattctt
cccgactctatcccatctgcccctggaacgctgcctcatttcatcgaggagcccgaagat
gcatacatcatcaagagcaacccgattgcactcaggtgcaaagcaaggccagccatgcag
atcttcttcaaatgcaatggggagtgggtccatcagaatgaacatgtgtccgaggagagc
ctggatgagagctcaggcttgaaggtccgggaagtgtttatcaatgtcaccaggcagcaa
gtggaggacttccatgggccagaggactactggtgccagtgtgtagcgtggagccacctg
ggaacgtccaagagtaggaaggcatctgtgcgcatagcctatttacggaaaaactttgaa
caagatccacaaggcagggaggttcctattgaaggcatgatcgtgctgcattgtcgcccg
ccagagggagttccagcagcagaggtggaatggctgaaaaatgaggagcccatcgactcc
gaacaggatgagaacattgacaccagggctgaccataacttgatcatcagacaggcccgg
ctgtcagactcagggaattacacctgtatggcagccaacatcgtggccaagaggaggagc
ctctcagcaactgtggtggtctacgtgaatggaggctggtcttcctggacagagtggtca
gcctgcaatgttcgctgtggtagaggatggcagaaacgttcccggacctgcaccaacccc
gctcctctcaatggtggggccttttgtgagggaatgtcagtgcagaaaataacctgcact
gctctttgtcctgtggatggcagctgggaagtgtggagtgaatggtcagtctgcagccca
gagtgtgaacatcttcgtatccgtgagtgcacagctccacccccaagaaatgggggcaag
ttctgtgaaggtctcagccaggaatctgaaaactgcacagatggtctctgcattctagat
aaaaaacctcttcatgaaataaaaccccaaagatggagtaggagaggcattgagaatgcc
agcgacattgctttgtactccggcttgggtgcagccgtggtagctgttgcggtcctggtc
attggtgtcaccctctacagacggagccacagtgactacggagtggatgtcattgactct
tctgcattgacaggtggcttccagaccttcaacttcaaaacagttcgtcaaggaaattct
ctactactgaatcctgccatgcagccagatctgactgtgagccggacatacagcgggccc
atctgtctgcaggatccgctcgacaaggagctcatgacagagtcctcactcttcaatcct
ttatctgacatcaaagtcaaagtccagagctcatttatggtttccctgggagtgtctgag
agagcggagtaccatggcaagaatcactcggggactttcccccatggaaacaaccgcgga
ttcagtacaatacatcccagaaacaaaacgccgtacatccaaaatctgtcatcactgccg
acaaggacagagctgaggacaactggtgtctttggccatttagggggacgcttagtaatg
ccaaatacaggggtgagtctactcataccacatggtgccatcccagaggagaattcttgg
gagatttatatgtcaatcaaccaaggtgaaccgagcctgcagtcagatggatctgaggtt
ctcctgagtcctgaagtcacctgtgggcctccagatatgcttgtcacaactccctttgcg
ctgaccatccctcactgtgcagacgtcagttcagagcactggaacattcacctgaagaag
aggacccagcaggggaagtgggaggaagtgatgtcagtggaggatgagtccacatcctgt
tactgcctcttggatccctttgcctgtcacgtgctgcttgatagctttggaacgtatgcc
ctcacaggagagccaatcacagactgtgccgtaaagcagctcaaggtggctgtgtttggc
tgcatgtcctgtaactccttggattacaacctgagagtttactgtgtggacaatactcct
tgtgcatttcaggaagtgatttctgacgaacggcaccaaggcggccagctcctggaagaa
ccaaagctgctgcatttcaaagggaatacattcagtctccaggtctctgtccttgacatc
cctcccttcctctggaggatcaaaccgttcactgcatgccaggaagtccccttctcccga
gtgtggagcagcaaccggcagcccctgcactgtgccttctccctggagcgctacacgccc
accaccacccagctgtcctgcaaaatctgcattcggcagctcaaaggccatgaacagatc
ctccaagtgcagacatccatcctagagagtgaacgagaaaccatcactttcttcgcacaa
gaggacagtacctttcctgcacagactggcccaaaagccttcaaaattccctattccatc
agacagaggatctgcgccacgtttgataccccaaatgccaaaggcaaggactggcagatg
ttagcacagaagaacagcatcaataggaatttatcatatttcgctacccaaagcagccct
tccgctgtcattttgaacctctgggaagctcgtcatcagcaggatggggacctcgactcg
ctcgcctgtgcccttgaggagattgggaggacacacacgaaactatccaacatcacagag
ccacagattgatgatgctgacttcaactacagcaggcaaaatggactctag

DBGET integrated database retrieval system